(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26700

AL161565.AT4G26700   Location/Qualifiers
FT   CDS_pept        join(160935..161021,161095..161265,161365..161606,
FT                   161692..161863,161976..162014,162096..162164,
FT                   162245..162361,162649..162860,163134..163286,
FT                   163428..163627,163726..163883,163983..164079,
FT                   164174..164265,164347..164601)
FT                   /gene="AT4g26700"
FT                   /product="fimbrin-like protein (ATFIM1)"
FT                   /note="one AA substitution to fimbrin-like protein -
FT                   Arabidopsis thaliana, PID:g2905893"
FT                   /note="nearly identical with fimbrin 1, PID:g2811230,
FT                   partial CDS"
FT                   /note="contains EST gb:Z29761, Z29762"
FT                   /db_xref="GOA:Q7G188"
FT                   /db_xref="InterPro:IPR001589"
FT                   /db_xref="InterPro:IPR001715"
FT                   /db_xref="InterPro:IPR011992"
FT                   /db_xref="InterPro:IPR036872"
FT                   /db_xref="InterPro:IPR039959"
FT                   /db_xref="PDB:1PXY"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q7G188"
FT                   /protein_id="CAB79525.1"
FT                   /translation="MSGYVGVVVSDPWLQSQFTQVELRTLNSKYVSVKNQNGKVTIEDL
FT                   PPLFAKLKALSATFKEDEIKGMLGELGSDTSTDVSFEEFLKIYLNLLSKAAEKSGGHHK
FT                   NSSSFLKACTTTLLHTIYQSEKGPFVQHINRYLGDDPFLKQFLPLDPHSNQLYELVKDG
FT                   VLLCKLINVAVPGTIDERAINTKRVLNPWERNENHTLCLNSAKAVGCSVVNIGTQDLAE
FT                   GRPHLVLGLISQLIKIQVLADLNLKKTPQLVELLEDSDDVEELLRLPPEKVLLKWMNFH
FT                   LKKGGYKKTVSNFSADLKDAQAYAFLLNVLAPEHCDPATLDAKDPLERAELVLSHAERM
FT                   NCKRYLTAEEIVEGSSTLNLAFVAQIFHERNGLNKDGKYAFAEMMTEDVETCRDERCYR
FT                   LWINSLGIDSYVNNVFEDVRNGWILLEVLDKVSPSSVNWKHASKPPIKMPFRKVENCNQ
FT                   VIKIGKQLKFSLVNVAGNDIVQGNKKLILGLLWQLMRFHMLQLLKSLRSRTLGKEMTDA
FT                   DILSWANRKVRTMGRKLQIESFKDKSLSSGLFFLNLLWAVEPRVVNWNLVTKGETDDEK
FT                   RLNATYIVSVARKLGCSVFLLPEDIVEVNQKMILILTASIMYWSLQRHSRESSDSSSTQ
FT                   STTTTCTSTASSPAPSVTEEEEVSSLSGEVTSLAVGDAVSEITTVSEEASIE"
     atgtctgggt acgtgggtgt tgtcgtttct gatccatggc tacagagcca gttcactcaa        60
     gtcgaacttc ggactctcaa ttccaagtat gtgtcggtga agaatcagaa tggaaaggtc       120
     actattgaag atctccctcc tctatttgca aagctgaagg cacttagtgc aacatttaag       180
     gaagacgaaa tcaagggtat gctaggggaa ttgggttctg atacaagcac tgatgtgagt       240
     tttgaagagt ttctcaagat atatctcaac ttactaagta aagcagctga gaaatctggt       300
     ggtcatcata agaactcatc ctcgtttctg aaagcttgta caacgacact tcttcacact       360
     atatatcagt cggagaaggg tccttttgtt cagcacatca atagatatct aggggatgac       420
     ccctttttga agcagttcct tcctcttgac cctcattcta atcaattgta tgaacttgtg       480
     aaagatggtg tccttctatg taagcttata aatgtagctg ttcccgggac aattgatgaa       540
     cgagcgatca acactaagag ggtacttaat ccgtgggaga gaaatgagaa tcacacgctt       600
     tgtctcaact ctgctaaagc tgttggatgc tctgttgtta atattggcac acaagacctg       660
     gccgaaggac ggcctcacct ggtgctcgga ttgatttcac aactcataaa gattcaagta       720
     cttgctgatc tcaatttaaa gaagacgcct cagcttgttg agttgcttga ggacagcgat       780
     gatgtcgagg agttgctgag attaccccct gagaaagtct tactgaaatg gatgaacttc       840
     catcttaaga aagggggtta caagaaaacc gtctcaaact tttccgcaga tttgaaggat       900
     gcacaagcgt atgcctttct gctcaatgtt ctcgcacctg aacactgtga cccggctaca       960
     ctagatgcaa aggatcctct tgaaagagct gaattggttc tcagtcatgc agagagaatg      1020
     aactgcaagc gatacttgac tgcagaggag atcgttgaag gatcttcaac tttgaatctt      1080
     gcctttgtgg cacaaatctt ccatgaaagg aatggtctaa acaaggatgg taagtatgca      1140
     tttgcggaga tgatgaccga agacgtagag acttgtagag atgaacgatg ctaccggcta      1200
     tggatcaaca gcctcgggat tgacagttat gtcaataatg tatttgaaga tgttagaaat      1260
     ggatggattc ttcttgaggt tcttgacaag gtctctccca gttcagtcaa ctggaagcat      1320
     gcttccaaac caccgattaa gatgccgttt agaaaagtag agaactgcaa tcaagtcata      1380
     aagatcggga aacagctaaa attctcactt gtaaatgtag ctggaaatga catagttcaa      1440
     gggaataaga agctcattct tggtctctta tggcagttga tgagattcca tatgctccaa      1500
     cttctcaaga gtctcagatc tcggacacta ggtaaagaga tgactgatgc agatatcctc      1560
     agctgggcca acaggaaagt aagaacaatg ggacgaaaat tgcaaatcga gagtttcaag      1620
     gacaagagtc tatcgagtgg gttattcttc ctcaaccttc tatgggcggt tgaaccaaga      1680
     gttgtgaact ggaatcttgt caccaagggt gaaacagatg atgagaagag gttgaatgct      1740
     acatacatag ttagtgtcgc aagaaagctc ggttgttcgg ttttcttgtt acctgaagat      1800
     atcgtggagg tgaatcagaa gatgatccta attttaacgg caagtataat gtactggagt      1860
     cttcagagac attcacggga gagttcagat tcgtcgtcaa ctcagagcac cacaacgacg      1920
     tgcaccagca cagcctcgtc ccctgcccca tctgtcacag aagaggagga agtctcctca      1980
     ttgagcggtg aagtcacgag cttggccgtt ggtgatgcgg tttctgaaat caccacggtc      2040
     tcagaggaag catccatcga atag                                             2064
//

If you have problems or comments...

PBIL Back to PBIL home page