(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26720

AL161565.AT4G26720   Location/Qualifiers
FT   CDS_pept        complement(join(167572..167622,167705..167783,
FT                   167874..168142,168226..168301,168390..168475,
FT                   168554..168616,168727..168879,169189..169329))
FT                   /gene="AT4g26720"
FT                   /product="phosphoprotein phosphatase (PPX-1)"
FT                   /note="Contains Serine/threonine specific protein
FT                   phosphatases signature AA108-113"
FT                   /note="contains EST gb:H77057, N37575, T44811, AI992913.1,
FT                   T43788, H77152, AW004364.1, AI996959.1, R29983, R29984,
FT                   H36585, N37622, T42314, T41959, T41565, AA042143"
FT                   /db_xref="GOA:P48529"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006186"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/Swiss-Prot:P48529"
FT                   /protein_id="CAB79527.1"
FT                   /translation="MSDLDRQIGQLKRCEPLSESEVKALCLKAMEILVEESNVQRVDAP
FT                   VTLCGDIHGQFYDMMELFKVGGDCPKTNYLFMGDFVDRGYYSVETFLLLLALKVRYPDR
FT                   ITLIRGNHESRQITQVYGFYDECLRKYGSSNVWRYCTDIFDYMSLSAVVENKIFCVHGG
FT                   LSPAIMTLDQIRTIDRKQEVPHDGAMCDLLWSDPEDIVDGWGLSPRGAGFLFGGSVVTS
FT                   FNHSNNIDYIARAHQLVMEGYKWMFDSQIVTVWSAPNYCYRCGNVASILELDENLNKEF
FT                   RVFDAAQQDSRGPPAKKPAPDYFL"
     atgtcagacc tagatcggca aatagggcag cttaagcgat gcgaaccatt gagcgaatcg        60
     gaggtgaagg ctctttgcct caaagccatg gaaattcttg ttgaagagag taatgttcag       120
     agagttgatg cccctgtcac tttatgtggt gacatccatg ggcagttcta tgatatgatg       180
     gagcttttca aagttggggg tgattgtcct aagaccaact atttgtttat gggagatttt       240
     gttgatcgtg gatattattc ggttgagaca tttctacttc tactcgcact caaggttaga       300
     tatccagacc gcataactct catcagagga aaccatgaaa gcaggcaaat cacacaggtt       360
     tatggatttt atgatgagtg tttgcgtaaa tatggctctt caaatgtctg gagatactgc       420
     accgacattt ttgactacat gagtctttca gctgttgtgg agaacaagat attctgtgtt       480
     catggtggtc tttctccagc tattatgact cttgatcaga ttaggacaat tgaccggaag       540
     caagaagtac cacatgatgg tgccatgtgt gatctcctat ggtctgatcc tgaagatatt       600
     gttgatggct ggggattgag ccctcgtggt gccggattcc tttttggtgg cagtgttgtc       660
     acgtctttta accactcaaa caacatagac tacatagccc gtgcccatca actagttatg       720
     gagggttaca aatggatgtt tgatagccag attgtgacag tgtggtcagc cccaaattac       780
     tgttacagat gcggtaatgt ggcttcaatt ctagagcttg acgagaatct aaataaagaa       840
     ttccgtgtgt ttgatgcagc ccagcaggac tcgagagggc ctcccgccaa aaagccggcc       900
     cctgattact tcctataa                                                     918
//

If you have problems or comments...

PBIL Back to PBIL home page