(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26730

AL161565.AT4G26730   Location/Qualifiers
FT   CDS_pept        join(169754..169825,169930..170484)
FT                   /gene="AT4g26730"
FT                   /product="putative protein"
FT                   /note="similarity to H+-transporting ATP synthase, (EC
FT                   3.6.1.34) chain a - Synechocystis, GB:AB001339"
FT                   /db_xref="GOA:Q9SZ14"
FT                   /db_xref="InterPro:IPR013216"
FT                   /db_xref="InterPro:IPR029063"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ14"
FT                   /protein_id="CAB79528.1"
FT                   /translation="MERNVEKMLNRVSVVFLSIGTVLMHLPLPKKNARIWFSGAWKSRL
FT                   SSFSTYFLRFRDLGFIQNHTKALCLSDGAGHAPMALSQIGLSDVTAVELVDSIPLVKRA
FT                   DPHNLPFFDRVFDFVFTAHLAEALFPWRFVEEMERTVRRGGFCVVAVDECSGDDVRDIA
FT                   RFFHNSKIVDVANVTLERVKRTSILFKLQDSKRTSILFKVQDSLS"
     atggagagaa acgttgagaa gatgctgaac agagtttcag tcgtgttctt aagcatcgga        60
     acagtgttaa tgcatcttcc tctcccaaag aagaacgctc gaatctggtt ctctggagct       120
     tggaaatcgc gtctatcctc cttctctacc tacttcctcc gatttcgcga tctcggattc       180
     attcaaaatc acaccaaagc tctctgtctt tccgacggag caggccatgc tccgatggct       240
     ctttctcaga tcggattatc cgacgttacc gcagttgaat tggttgattc gattcctctt       300
     gtgaaaagag ctgatcctca taaccttccg tttttcgacc gtgtctttga ttttgtcttt       360
     actgcacatc tagctgaagc tctgtttccg tggcggttcg tggaggagat ggagaggacg       420
     gtgcgacgcg gtgggttttg tgtggttgcg gttgatgaat gtagtggaga tgatgttaga       480
     gacattgcta ggttttttca taattccaag atcgttgatg ttgctaatgt aaccttagaa       540
     agagtcaaaa gaactagtat actattcaaa cttcaagact ctaaaaggac tagtatacta       600
     ttcaaagttc aagactctct ttcatga                                           627
//

If you have problems or comments...

PBIL Back to PBIL home page