(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26740

AL161565.AT4G26740   Location/Qualifiers
FT   CDS_pept        complement(join(170966..171128,171255..171380,
FT                   171471..171565,171690..171775,171865..172014,
FT                   172336..172453))
FT                   /gene="AT4g26740"
FT                   /product="embryo-specific protein 1 (ATS1)"
FT                   /note="contains EST gb:Z27053, Z29900"
FT                   /db_xref="GOA:O81270"
FT                   /db_xref="InterPro:IPR007736"
FT                   /db_xref="UniProtKB/Swiss-Prot:O81270"
FT                   /protein_id="CAB79529.1"
FT                   /translation="MGSKTEMMERDAMATVAPYAPVTYHRRARVDLDDRLPKPYMPRAL
FT                   QAPDREHPYGTPGHKNYGLSVLQQHVSFFDIDDNGIIYPWETYSGLRMLGFNIIGSLII
FT                   AAVINLTLSYATLPGWLPSPFFPIYIHNIHKSKHGSDSKTYDNEGRFMPVNLELIFSKY
FT                   AKTLPDKLSLGELWEMTEGNRDAWDIFGWIAGKIEWGLLYLLARDEEGFLSKEAIRRCF
FT                   DGSLFEYCAKIYAGISEDKTAYY"
     atggggtcaa agacggagat gatggagaga gacgcaatgg ctacggtggc tccctatgcg        60
     ccggtcactt accatcgccg tgctcgtgtt gacttggatg atagacttcc taaaccttat       120
     atgccaagag cattgcaagc accagacaga gaacacccgt acggaactcc aggccataag       180
     aattacggac ttagtgttct tcaacagcat gtctccttct tcgatatcga tgataatggc       240
     atcatttacc cttgggagac ctactctgga ctgcgaatgc ttggtttcaa tatcattggg       300
     tcgcttataa tagccgctgt tatcaacctg acccttagct atgccactct tccggggtgg       360
     ttaccttcac ctttcttccc tatatacata cacaacatac acaagtcaaa gcatggaagt       420
     gattcaaaaa catatgacaa tgaaggaagg tttatgccgg tgaatcttga gttgatattt       480
     agcaaatatg cgaaaacctt gccagacaag ttgagtcttg gagaactatg ggagatgaca       540
     gaaggaaacc gtgacgcttg ggacattttt ggatggatcg caggcaaaat agagtgggga       600
     ctgttgtact tgctagcaag ggatgaagaa gggtttttgt caaaagaagc tattaggcgg       660
     tgtttcgatg gaagcttgtt cgagtactgt gccaaaatct acgctggtat cagtgaagac       720
     aagacagcat actactaa                                                     738
//

If you have problems or comments...

PBIL Back to PBIL home page