(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26750

AL161565.AT4G26750   Location/Qualifiers
FT   CDS_pept        complement(join(173023..173763,174034..174177,
FT                   174278..174353,174869..174978,175278..175378,
FT                   175464..175557))
FT                   /gene="AT4g26750"
FT                   /product="putative protein"
FT                   /note="similarity to extensin precursor - tomato,
FT                   Pir2:S25299"
FT                   /note="contains EST gb:AI994725.1, N37698, T46339,
FT                   AA404836"
FT                   /db_xref="GOA:Q9SZ15"
FT                   /db_xref="InterPro:IPR023175"
FT                   /db_xref="InterPro:IPR039431"
FT                   /db_xref="InterPro:IPR041212"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ15"
FT                   /protein_id="CAB79530.1"
FT                   /translation="MSNPNEPARALLPYLQRADELQKHEPLVAYYCRLYAMERGLKIPQ
FT                   SERTKTTNSILMSLINQLEKDKKSLTLSPDDNMHVEGFALSVFAKADKQDRAGRADLGT
FT                   AKTFYAASIFFEILSQFGPVPPDIEQKHKYAAWKAADIRKAIKEGRKPTPGDPVDDDTD
FT                   LSIPSSGPSGSYDHSASDTNTTSHHRTELDPPHDSNDDSSHHQFPEVPQHPLPPRFYDN
FT                   PTNDYPADVPPPPPSSYPSNDHLPPPTGPSDSPYPHPYSHQPYHQDPPKHMPPPQNYSS
FT                   HEPSPNSLPNFQSYPSFSESSLPSTSPHYPSHYQNPEPYYSSPHSAPAPSSTSFSSAPP
FT                   PPPYSSNGRINIAPVLDPAPSSAQKYHYDSSYQPGPEKVAEALKAARFAVGALAFDEVS
FT                   TAVEHLKKSLELLTNPSAGAGH"
     atgtcgaacc caaacgaacc agccagggct cttctgcctt acctgcaacg tgccgatgag        60
     ctgcagaagc atgaaccact tgttgcttat tactgtcggc tatatgcaat ggaacgagga       120
     ttgaagattc cgcagagcga gagaactaag accaccaatt cgattctcat gtctctcatt       180
     aatcaactcg aaaaggataa aaaatcattg actctgtccc cagatgacaa tatgcatgtg       240
     gaggggtttg cacttagtgt ctttgctaag gcagacaagc aggatcgtgc aggaagagca       300
     gacttgggca ctgccaaaac tttttatgct gcgagcatct tctttgaaat tctgagccag       360
     tttggtcccg tacctcctga tatagagcag aaacacaagt atgctgcttg gaaggctgct       420
     gacataagga aagccattaa agaaggaagg aagcccactc caggtgatcc tgtggatgat       480
     gatactgatt tatccatccc atcaagcggt cctagtggct cctatgatca cagtgcaagt       540
     gataccaaca caacaagtca tcatagaaca gagcttgatc caccccatga ctcgaatgat       600
     gactccagcc accatcaatt ccctgaagtg ccacaacacc ctctacctcc caggttttat       660
     gacaatccga ccaacgatta tcccgcagat gtcccacctc caccaccgtc ttcttaccct       720
     tccaacgatc atcttccccc tcccacagga ccatcagact ccccttaccc gcatccttac       780
     agtcatcaac cataccacca agacccgcca aaacacatgc cgccaccgca aaactactca       840
     tctcatgagc cttctccaaa ttctctccct aatttccaat cttatcctag ctttagtgag       900
     agcagcctcc catccacttc tccccactac ccttctcact accaaaaccc agaaccttac       960
     tattcttctc cgcactctgc acctgctcct tcttccacaa gcttctcctc tgctcctcct      1020
     cctccacctt actcatcaaa cgggcgtatc aatattgctc ccgtgctaga tcctgcaccg      1080
     agttcagctc agaagtacca ttacgatagc agctaccagc cagggcctga gaaggttgca      1140
     gaggcactca aggctgctag attcgctgtg ggagctttgg cttttgatga agtctcgact      1200
     gctgtagaac atctcaagaa gtcacttgag ttgctaacaa atccatcggc cggtgccggt      1260
     cactga                                                                 1266
//

If you have problems or comments...

PBIL Back to PBIL home page