(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26760

AL161565.AT4G26760   Location/Qualifiers
FT   CDS_pept        complement(join(176519..176704,176798..177109,
FT                   177187..177342,177505..177720,177797..178072,
FT                   178127..178330,178404..178475))
FT                   /gene="AT4g26760"
FT                   /product="putative protein"
FT                   /note="similarity to hypothetical protein, Arabidopsis
FT                   thaliana chromosome II BAC T6A23, PID:g3786000"
FT                   /note="contains EST gb:AI992936.1, T41951, R30266"
FT                   /db_xref="GOA:Q8LEG3"
FT                   /db_xref="InterPro:IPR007145"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LEG3"
FT                   /protein_id="CAB79531.1"
FT                   /translation="MAVTEAENPLLGEITCGTLLQKLQEIWDEVGESDEERDKLLLQIE
FT                   EECLNVYKKKVELAAKSRAELLQTLSDATVELSNLTTALGEKSYIDICDSMSLFPLQPD
FT                   KTSGTIKEQLSAIAPALEQLWQQKEERVRAFSDVQSQIQKICEEIAGGLNNGPHVVDET
FT                   DLSLKRLDDFQRKLQELQKEKSDRLQKVLEFVSTVHDLCAVLRLDFLSTVTEVHPSLDE
FT                   ANGVQTKSISNETLARLAKTVLTLKEDKMQRLKKLQELATQLTDLWNLMDTSDEERELF
FT                   DHVTSNISASVHEVTASGALALDLIEQAEVEVDRLDQLKSSRMKEIAFKKQSELEEIYA
FT                   RAHIEIKPEVVRERIMSLIDAGNTEPTELLADMDSQIAKAKEEAFSRKEILDRVEKWMS
FT                   ACEEESWLEDYNRDQNRYSASRGAHLNLKRAEKARILVSKITGKNFQKSLLVITTHRIK
FT                   LRLKNISYFVCASYG"
     atggcagtga cagaagcaga aaatcctctt cttggtgaaa tcacttgtgg caccttacta        60
     cagaagttgc aggaaatctg ggatgaggtt ggggagagtg atgaagaacg agacaaactg       120
     cttctacaga ttgaggaaga gtgtctgaat gtttacaaaa agaaagttga gctagccgca       180
     aaatctcgtg cagagcttct tcagactttg tcagatgcca ctgttgaact ttccaatctc       240
     acaactgctc tcggggaaaa aagctatatc gacatttgtg attcaatgtc tttgtttcca       300
     ttgcagcctg ataagacttc aggaacgatc aaagaacaac tttctgcaat agcacctgcg       360
     cttgaacaac tttggcaaca gaaagaggaa agggtccggg cattttctga tgtacaatca       420
     cagattcaga agatatgtga ggagatcgct ggcggattga acaatggacc tcatgtggtt       480
     gatgagactg acttgtctct aaagagatta gatgacttcc agaggaaact ccaagagctc       540
     cagaaagaga agagtgatag gttacagaag gtgctcgagt ttgtgagcac ggtgcatgat       600
     ctatgtgccg tccttcgttt agatttctta agcactgtca ccgaagttca tccgagctta       660
     gatgaggcaa atggtgttca aaccaagagc attagcaatg aaacacttgc aaggttggct       720
     aagactgtct tgactcttaa agaagataaa atgcaaagac ttaagaagct tcaagaacta       780
     gctactcagc taactgatct atggaatctg atggatactt ctgatgagga aagggagctt       840
     tttgaccatg ttacctctaa catttcagct tcagttcatg aagtgactgc ctctggtgct       900
     ctcgcacttg atcttatcga acaggctgag gtggaagtgg ataggcttga tcaactgaaa       960
     tctagcagaa tgaaggaaat tgcattcaaa aagcaatcag agcttgagga gatatatgct      1020
     cgtgctcaca tagaaataaa accagaggtt gttcgtgaga ggatcatgtc gttgattgat      1080
     gctgggaata ctgaacctac tgagttactg gctgacatgg atagccagat cgcaaaggcc      1140
     aaggaggaag cctttagtag aaaagaaatt ttagaccgtg tagagaaatg gatgtcagct      1200
     tgtgaggaag agagctggct cgaagattac aatcgagatc agaacaggta tagtgcaagc      1260
     cgaggtgcgc atttgaatct caagagagct gagaaagctc ggattctggt cagcaagatt      1320
     actggtaaga acttccaaaa gtctctctta gttattacta cacatagaat taaactgaga      1380
     ctgaagaata tatcatactt tgtttgtgca agctatggtt ga                         1422
//

If you have problems or comments...

PBIL Back to PBIL home page