(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26780

AL161565.AT4G26780   Location/Qualifiers
FT   CDS_pept        complement(join(182241..182339,182435..182563,
FT                   182643..182810,182895..183338,183640..183735))
FT                   /gene="AT4g26780"
FT                   /product="grpE like protein"
FT                   /note="gDNA differs from cDNA AR192 (PID:g1669597) at two
FT                   positions but gDNAwas confirmed with a 10 fold coverage"
FT                   /note="nearly identical to cDNA AR192, that complements
FT                   pheromone receptorent mutant of Sizosaccharomyces pombe"
FT                   /note="Contains grpE protein signature AA253-296"
FT                   /note="contains EST gb:AI996540.1"
FT                   /db_xref="GOA:Q8LB47"
FT                   /db_xref="InterPro:IPR000740"
FT                   /db_xref="InterPro:IPR009012"
FT                   /db_xref="InterPro:IPR013805"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8LB47"
FT                   /protein_id="CAB79533.1"
FT                   /translation="MLVLRILSRVTRNAGIRSSLSAVTLPARNQTPLVPAQMSMMDSFA
FT                   LQRFNFSSSTSPESDEKKTHTEASKTSEEKPTAEANQPGLDSESKDSVTDSAKRKRKGA
FT                   KGAASSSSESDSESDDDELSADDLVKLVAEKEELLSEKEEEIKQLKDKVLRTYAEMENV
FT                   MDRTRRDAENTKKYAVQNFAKSLLDVADNLGRASSVVKESFSKLDTSEDSAGAAPLLKT
FT                   LLEGVEMTEKQLAEVFKKFGMEKYDPINEPFDPNRHNAVFQVPDASKPEGTVAHVLKSG
FT                   YTLYDRVIRPAEVGVTQGGENQEEKKESDA"
     atgttggttt tgagaatttt gtcgcgagta acccgcaacg cgggcatacg ctcatctcta        60
     tccgccgtca ctcttccggc gaggaatcag actcctcttg ttccagctca gatgtctatg       120
     atggattcgt ttgcactgca aaggttcaat ttttcttcct ctacctcgcc tgaatcagat       180
     gagaagaaga cccacactga ggcctcaaag acaagtgaag agaaacctac agctgaggca       240
     aaccaaccag gtcttgactc tgaatctaaa gattctgtga cagattctgc aaaaagaaag       300
     cggaaaggtg ctaaaggagc tgcatcttca tcttctgaat cagattctga gagtgatgat       360
     gatgaattgt cagccgatga tttggtgaag ctcgtagctg agaaggaaga gctactgtct       420
     gagaaggaag aagagattaa gcagttgaaa gacaaagttc ttcgcactta tgctgagatg       480
     gagaatgtca tggacagaac aagacgtgat gctgaaaaca ccaaaaagta tgccgtacag       540
     aattttgcaa agagcctatt ggatgtggcg gataatcttg gaagagcttc ttcggttgtc       600
     aaagaaagct tctcaaagct tgacacctca gaagattctg ctggagcagc tccactatta       660
     aagacccttt tagaaggagt ggagatgact gagaaacagc ttgctgaggt atttaagaaa       720
     tttggtatgg agaagtatga tcctataaac gagccatttg atccaaacag acataacgca       780
     gtgttccaag tccctgatgc ttctaagcca gaaggcacag ttgctcatgt cttgaagtct       840
     ggatacacgc tgtatgaccg agttataaga ccagctgagg ttggtgttac ccagggagga       900
     gagaaccaag aagaaaagaa agagtctgat gcttaa                                 936
//

If you have problems or comments...

PBIL Back to PBIL home page