(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26790

AL161565.AT4G26790   Location/Qualifiers
FT   CDS_pept        join(185034..185405,185466..185997,186131..186324)
FT                   /gene="AT4g26790"
FT                   /product="putative APG protein"
FT                   /note="similarity to proline-rich protein APG - Arabidopsis
FT                   thaliana, EMBL:X60377"
FT                   /note="Contains Aminotransferases class-V
FT                   pyridoxal-phosphate attachment site AA216-234"
FT                   /note="contains EST gb:T04213, T46442, T42101, AI992441.1,
FT                   H36224, H77179, T42929, N97259"
FT                   /db_xref="GOA:Q8VY93"
FT                   /db_xref="InterPro:IPR001087"
FT                   /db_xref="InterPro:IPR035669"
FT                   /db_xref="InterPro:IPR036514"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8VY93"
FT                   /protein_id="CAB79534.1"
FT                   /translation="MQRNRVLAFLLLAAQLLVKIPETCAKFPALIVFGDSTVDSGNNNQ
FT                   ISTVLKSNFQPYGRDYFDGKATGRFSNGRIAPDFISEGLGLKNAVPAYLDPAYNIADFA
FT                   TGVCFASAGTGLDNATSAVLISDMLSLNCHRFLKSVMPLWKEVEYYKEYQTRLRSYLGE
FT                   EKANEIISESLYLISIGTNDFLENYYLLPRKLRKYSVNEYQYFLIGIAADFVTDIYRLG
FT                   ARKMSLSGLSPFGCLPLERTTQLFYGSKCIEEYNIVARDFNIKMEEKVFQLNRDLNGIQ
FT                   LVFSNPYDLVSEIIYHPEAFGFENVRSACCGTGYYEMSYLCDKMNPFTCSDASKYVFWD
FT                   SFHPTEKTNAIVANHVLKYDLSRFQ"
     atgcagcgaa acagagttct tgcgttcttg ttgctagcag ctcagctctt ggtgaagata        60
     cctgaaacgt gtgcaaaatt tcccgcactt atcgtatttg gtgactcaac tgttgattca       120
     ggcaacaaca accagatttc tactgttctg aagagcaatt tccagccata tggccgggat       180
     tactttgacg gcaaagcgac tgggagattt tcaaatggcc ggattgcacc agacttcatt       240
     tctgaaggtt tgggactcaa gaacgcagtc cctgcctacc tagatccagc atacaacatt       300
     gcagactttg ccactggtgt ctgtttcgct tcagctggaa ccggcttaga caatgcaacc       360
     tctgccgtgt taatttctga catgctttct ctgaattgtc atcgatttct aaagtctgta       420
     atgccgctat ggaaggaagt ggaatactac aaagaatacc aaaccaggct aagaagctac       480
     ttgggtgaag agaaagctaa tgagattatt agtgaatcac tttacctgat tagtatcgga       540
     accaacgatt tcctggagaa ttactatctt cttccccgca agttacggaa gtactcagtg       600
     aacgagtacc aatatttcct gataggaata gcagcagatt tcgtgacaga tatatacaga       660
     ctcggagctc ggaagatgtc tttgtcggga ctctctcctt ttggatgctt acccctggaa       720
     agaacaactc agctctttta tggaagcaaa tgtattgaag aatacaacat tgtggctaga       780
     gatttcaaca tcaagatgga agagaaagtc ttccagttga acagagatct gaacggaatc       840
     cagctggtgt tttcaaatcc atatgacctt gtttcagaaa tcatatacca tcctgaagca       900
     ttcggtttcg aaaacgtaag aagtgcgtgt tgcggaacgg gatactatga gatgagctac       960
     ttgtgtgata aaatgaaccc attcacatgt tcggatgcaa gcaaatatgt attttgggac      1020
     tcatttcacc caacagagaa gacaaacgcc atcgtagcaa atcatgttct gaaatacgac      1080
     ttatctcggt ttcagtga                                                    1098
//

If you have problems or comments...

PBIL Back to PBIL home page