(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26800

AL161565.AT4G26800   Location/Qualifiers
FT   CDS_pept        187314..188633
FT                   /gene="AT4g26800"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis putative proteins"
FT                   /note="contains EST gb:AA728420"
FT                   /db_xref="InterPro:IPR002885"
FT                   /db_xref="InterPro:IPR011990"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q9SZ20"
FT                   /protein_id="CAB79535.1"
FT                   /translation="MAYSYPLPSIVEFNKVLTAIAKMQMYDVVINLWKRIENAEGIEIS
FT                   PDLYTCNILVNCFCRCFQPSSALSYLGKMMKLGIEPDIVTASSLVNGFCLSNSIKDAVY
FT                   VAGQMEKMGIKRDVVVDTILIDTLCKNRLVVPALEVLKRMKDRGISPNVVTYSSLITGL
FT                   CKSGRLADAERRLHEMDSKKINPNVITFSALIDAYAKRGKLSKVDSVYKMMIQMSIDPN
FT                   VFTYSSLIYGLCMHNRVDEAIKMLDLMISKGCTPNVVTYSTLANGFFKSSRVDDGIKLL
FT                   DDMPQRGVAANTVSCNTLIKGYFQAGKIDLALGVFGYMTSNGLIPNIRSYNIVLAGLFA
FT                   NGEVEKALSRFEHMQKTRNDLDIITYTIMIHGMCKACMVKEAYDLFYKLKFKRVEPDFK
FT                   AYTIMIAELNRAGMRTEADALNRFYQKHVRQNESAPAEVS"
     atggcttatt cttaccctct accttcaatt gttgaattca ataaagtatt gactgctatt        60
     gctaagatgc agatgtatga tgttgtgatt aatctctgga aacgtattga gaatgctgaa       120
     ggtattgaaa tttcacctga tctctatact tgtaacattt tggtgaattg tttctgccgc       180
     tgctttcaac cctcttcggc tttatcttat cttgggaaga tgatgaagct tggtattgag       240
     cctgacattg tgactgctag ctcgctggtc aatggattct gtctcagtaa tagtattaag       300
     gatgctgttt atgtggctgg ccaaatggag aaaatgggaa tcaaacgtga tgttgtagtc       360
     gataccatac tcattgatac tctttgcaaa aatagacttg tggttcccgc gctggaggtt       420
     ctcaaacgta tgaaagacag aggaatttca ccgaatgttg ttacctacag ctctctcata       480
     actggccttt gtaaatccgg tagattggct gacgccgaga gacgactgca cgaaatggac       540
     tccaagaaaa tcaaccctaa tgttatcact ttcagtgcat taatcgatgc atatgcaaaa       600
     cgtgggaaac tgtcgaaggt tgatagtgtg tacaagatga tgatccaaat gtctatagat       660
     cctaatgttt tcacttacag ttcacttatc tacgggcttt gcatgcacaa tcgtgtagac       720
     gaggccatta aaatgcttga cttgatgata agcaaggggt gcaccccaaa tgtagtcact       780
     tacagtactc ttgcaaatgg atttttcaag tcgtcgaggg tagatgatgg gattaaactt       840
     ttagacgaca tgcctcaaag aggcgtggct gcaaacacag tctcttgcaa cactcttatc       900
     aagggctatt ttcaagcagg caagatagat ctcgctctag gagtttttgg atatatgact       960
     tctaatggtc tgattcccaa tattaggagc tacaacattg tgttagctgg tctatttgct      1020
     aatggggagg tagagaaagc attgagcaga ttcgagcata tgcaaaagac tagaaatgat      1080
     cttgatatta ttacatatac tatcatgatt catgggatgt gcaaggcttg tatggtgaaa      1140
     gaagcatatg atttgttcta taaactcaag ttcaaaagag tggagcccga ttttaaagca      1200
     tacacgataa tgatcgcaga attgaatagg gctggcatgc ggactgaagc agatgccttg      1260
     aatagatttt accaaaagca cgttcgccaa aacgaaagcg caccagctga agtatcctag      1320
//

If you have problems or comments...

PBIL Back to PBIL home page