(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26810

AL161565.AT4G26810   Location/Qualifiers
FT   CDS_pept        complement(join(189422..189568,189651..189824))
FT                   /gene="AT4g26810"
FT                   /product="putative protein"
FT                   /note="similarity to other Arabidopsis hypothetical
FT                   proteins"
FT                   /note="contains EST gb:AA713223"
FT                   /db_xref="InterPro:IPR003121"
FT                   /db_xref="InterPro:IPR019835"
FT                   /db_xref="InterPro:IPR036885"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ21"
FT                   /protein_id="CAB79536.1"
FT                   /translation="MLPQRLKKAITDNPKKLGNLIDLVNLPSTLRNFVGQSQISRLGCF
FT                   MRVWSYIKTNNLQDPKNKNVVICDEKLKSILLGKQRVELVDLPSLIKLHFPKEQKKNSQ
FT                   KI"
     atgctgcccc agaggttgaa gaaggctata acggataatc caaagaagct tgggaatttg        60
     attgacctcg tgaatcttcc atctactcta cggaactttg ttggtcaatc tcagatttcc       120
     cgtctgggtt gtttcatgcg tgtctggtcc tatatcaaga ccaacaatct tcaggatcct       180
     aagaacaaga atgtggtgat ttgtgatgag aagctcaaga gcattttgct cgggaagcag       240
     cgagtggagc tagtcgatct tccttctctt atcaagttgc attttcccaa agaacaaaag       300
     aagaattctc agaaaattta a                                                 321
//

If you have problems or comments...

PBIL Back to PBIL home page