(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26820

AL161565.AT4G26820   Location/Qualifiers
FT   CDS_pept        complement(190628..191356)
FT                   /gene="AT4g26820"
FT                   /product="hypothetical protein"
FT                   /note="Contains Prokaryotic membrane lipoprotein lipid
FT                   attachment site AA53-63"
FT                   /db_xref="GOA:Q9SZ22"
FT                   /db_xref="UniProtKB/TrEMBL:Q9SZ22"
FT                   /protein_id="CAB79537.1"
FT                   /translation="MDDEQNLVEEMNQQLLITVIDTEKVPELRPISSRSHQESEPANIS
FT                   HWSLLFKLFLAITIMGACVAGVTFVILITPTPPTVHVQSMHISFANHNLPVWSATFSIK
FT                   NPNEKLHVTYENPSVWLVHRGKLVSTARADSFWQKGGEKNEVIVKRNETKVIDEEAAWE
FT                   MEDEVAVTGGVVGLDMVFSGRVGFYPGTSALWGEQYMSAVCENVSAKLYNVDDEIYGTN
FT                   RSVLSFDGRLVCSVRLPKYP"
     atggatgatg aacaaaacct ggttgaagaa atgaatcaac agcttctgat aaccgtcatt        60
     gataccgaaa aagtcccgga actccgacca atatcatcac ggagccacca agaatccgaa       120
     ccagctaata tctcacactg gtcactactt ttcaaactct ttctagccat cacgatcatg       180
     ggtgcttgtg tagcaggtgt gacgtttgtc atattgatta cgccaactcc ccccacagta       240
     cacgtacaat caatgcatat atcgttcgcc aaccacaatc tcccggtctg gtccgcaacg       300
     ttctctatca aaaaccctaa cgagaaactc catgtcacgt acgagaatcc ttcagtgtgg       360
     ctggttcacc ggggaaagct cgtgtcgacc gcaagagctg attcgttctg gcagaaaggc       420
     ggagagaaga acgaggttat tgtcaagaga aacgaaacaa aagttatcga tgaagaggcg       480
     gcttgggaaa tggaggatga agtggcggtg acaggaggtg tggtgggtct tgatatggtg       540
     ttttctggga gagtagggtt ttatccagga acttctgctt tatggggaga acagtacatg       600
     tcagccgttt gtgagaatgt aagtgccaag ttgtataatg ttgatgacga gatctatggg       660
     acaaatagat cggttttgtc attcgatggt cgactagtat gcagtgtacg tctccctaaa       720
     tatccttag                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page