(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26840

AL161565.AT4G26840   Location/Qualifiers
FT   CDS_pept        join(194641..194715,195325..195474,195556..195633)
FT                   /gene="AT4g26840"
FT                   /product="ubiquitin-like protein"
FT                   /note="strong similarity to ubiquitin-like protein -
FT                   Arabidopsis thaliana (thale cress), PID:e259962"
FT                   /note="Contains Inorganic pyrophosphatase signature
FT                   AA80-86"
FT                   /note="contains EST gb:AI993416.1, N97261, AI100083,
FT                   T76809, H76365, Z17481, AW004209.1, F15343"
FT                   /db_xref="GOA:P55852"
FT                   /db_xref="InterPro:IPR000626"
FT                   /db_xref="InterPro:IPR022617"
FT                   /db_xref="InterPro:IPR029071"
FT                   /db_xref="UniProtKB/Swiss-Prot:P55852"
FT                   /protein_id="CAB79539.1"
FT                   /translation="MSANQEEDKKPGDGGAHINLKVKGQDGNEVFFRIKRSTQLKKLMN
FT                   AYCDRQSVDMNSIAFLFDGRRLRAEQTPDELDMEDGDEIDAMLHQTGGSGGGATA"
     atgtctgcaa accaggagga agacaagaag ccaggagacg gaggagctca catcaatctc        60
     aaagtcaagg gacaggatgg aaacgaggtt ttctttagga tcaagagaag cactcagctc       120
     aagaagctga tgaatgctta ctgtgaccgg caatctgtgg acatgaactc cattgctttc       180
     ttgtttgatg ggcgtcgtct tcgtgctgag caaactcccg atgagcttga catggaggat       240
     ggtgatgaga tcgatgcgat gctccatcag actggtggca gcggtggtgg tgctacggcc       300
     tga                                                                     303
//

If you have problems or comments...

PBIL Back to PBIL home page