(data stored in SCRATCH zone)

EMBL: AL161565.AT4G26850

AL161565.AT4G26850   Location/Qualifiers
FT   CDS_pept        complement(join(196437..196796,196880..197128,
FT                   197224..197404,197478..197746,197860..197919,
FT                   198002..198113,198172..198320))
FT                   /gene="AT4g26850"
FT                   /product="putative protein"
FT                   /note="contains EST gb:AI997404.1, H36924, AA598191,
FT                   AA404925, R90050, N96762, N96025, AA651325, AA605436,
FT                   AI993313.1"
FT                   /db_xref="GOA:Q8RWE8"
FT                   /db_xref="InterPro:IPR026506"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8RWE8"
FT                   /protein_id="CAB79540.1"
FT                   /translation="MLKIKRVPTVVSNYQKDDGAEDPVGCGRNCLGACCLNGTFWKPES
FT                   SFLIMLPLYACKNLVKSGEKLVISHEAIEPPVAFLESLVLGEWEDRFQRGLFRYDVTAC
FT                   ETKVIPGKYGFVAQLNEGRHLKKRPTEFRVDKVLQSFDGSKFNFTKVGQEELLFQFEAG
FT                   EDAQVQFFPCMPIDPENSPSVVAINVKTLVQRACPIEYGHVLLIPRVLDCLPQRIDHKS
FT                   LLLAVHMAAEAANPYFRLGYNSLGAFATINHLHFQAYYLAMPFPLEKAPTKKITTTVSG
FT                   VKISELLSYPVRSLLFEGGSSMQELSDTVSDCCVCLQNNNIPFNILISDCGRQIFLMPQ
FT                   CYAEKQALGEVSPEVLETQVNPAVWEISGHMVLKRKEDYEGASEDNAWRLLAEASLSEE
FT                   RFKEVTALAFEAIGCSNQEEDLEGTIVHQQNSSGNVNQKSNRTHGGPITNGTAAECLVL
FT                   Q"
     atgttgaaaa tcaaaagagt tccgaccgtt gtttcgaact accagaagga cgatggagcg        60
     gaggatcccg tcggctgtgg acggaattgc ctcggcgctt gttgccttaa cggtacgttt       120
     tggaaacctg aatcgtcttt tttaatcatg cttccattgt atgcatgtaa gaatctggta       180
     aaatccggag agaagcttgt aatcagtcat gaggctatag agcctcctgt agcttttctc       240
     gagtcccttg ttctcggaga gtgggaggat aggttccaaa gaggactttt tcgctatgat       300
     gtcactgcct gcgaaaccaa agttatcccg gggaagtatg gtttcgttgc tcagcttaac       360
     gagggtcgtc acttgaagaa gaggccaact gagttccgtg tagataaggt gttgcagtct       420
     tttgatggca gcaaattcaa cttcactaaa gttggccaag aagagttgct cttccagttt       480
     gaagctggtg aagatgccca agttcagttc ttcccttgca tgcctattga ccctgagaat       540
     tctcccagtg ttgttgccat caatgtaaag actcttgtgc agagagcttg tccgatagag       600
     tatggccatg tgctgctgat tcctcgtgtt cttgactgct tgcctcaaag gatcgatcac       660
     aaaagccttt tgcttgcagt tcacatggct gctgaggctg ctaatccata cttcagactc       720
     ggttacaaca gcttgggtgc ttttgccact atcaatcatc tccactttca ggcttattac       780
     ttggccatgc ctttcccact ggagaaagct cctaccaaga agataactac cactgttagt       840
     ggtgtcaaaa tctcagagct tctaagttac cctgtgagaa gtcttctctt tgaaggtgga       900
     agctctatgc aagaactatc tgatactgtt tcagactgct gtgtttgcct tcaaaacaac       960
     aacattcctt tcaacattct catctctgat tgtggaaggc agatcttctt aatgccacag      1020
     tgttacgcag agaaacaggc tctaggtgaa gtgagcccgg aggtattgga aacacaagtg      1080
     aacccagccg tgtgggagat aagtggtcac atggtactga agaggaaaga ggattacgaa      1140
     ggtgcttcag aggataacgc gtggaggctc cttgcggaag cttctctgtc ggaggaaagg      1200
     tttaaggagg ttactgctct cgcctttgaa gccataggtt gtagtaacca agaggaggat      1260
     cttgaaggaa ccatagttca tcagcaaaac tctagtggca atgttaacca gaaaagcaac      1320
     agaacccatg gaggtccgat cacaaatggg acggccgccg agtgccttgt ccttcagtga      1380
//

If you have problems or comments...

PBIL Back to PBIL home page