(data stored in SCRATCH3701 zone)

EMBL: AL591973.DNAA

AL591973.DNAA        Location/Qualifiers
FT   CDS_pept        318..1673
FT                   /transl_table=11
FT                   /gene="dnaA"
FT                   /product="Chromosomal replication initiation protein DnaA"
FT                   /db_xref="GOA:Q8YAW2"
FT                   /db_xref="InterPro:IPR001957"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR010921"
FT                   /db_xref="InterPro:IPR013159"
FT                   /db_xref="InterPro:IPR013317"
FT                   /db_xref="InterPro:IPR018312"
FT                   /db_xref="InterPro:IPR020591"
FT                   /db_xref="InterPro:IPR024633"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR038454"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAW2"
FT                   /protein_id="CAC98216.1"
FT                   /translation="MQSIEDIWQETLQIVKKNMSKPSYDTWMKSTTAHSLEGNTFIISA
FT                   PNNFVRDWLEKSYTQFIANILQEITGRLFDVRFIDGEQEENFEYTVIKPNPALDEDGIE
FT                   IGKHMLNPRYVFDTFVIGSGNRFAHAASLAVAEAPAKAYNPLFIYGGVGLGKTHLMHAV
FT                   GHYVQQHKDNAKVMYLSSEKFTNEFISSIRDNKTEEFRTKYRNVDVLLIDDIQFLAGKE
FT                   GTQEEFFHTFNTLYDEQKQIIISSDRPPKEIPTLEDRLRSRFEWGLITDITPPDLETRI
FT                   AILRKKAKADGLDIPNEVMLYIANQIDSNIRELEGALIRVVAYSSLVNKDITAGLAAEA
FT                   LKDIIPSSKSQVITISGIQEAVGEYFHVRLEDFKAKKRTKSIAFPRQIAMYLSRELTDA
FT                   SLPKIGDEFGGRDHTTVIHAHEKISQLLKTDQVLKNDLAEIEKNLRKAQNMF"
     gtgcaatcaa ttgaagacat ctggcaggaa acactgcaaa ttgttaaaaa aaatatgagt        60
     aaacctagtt acgatacatg gatgaaatca acaaccgctc attcacttga aggtaacacg       120
     tttattattt cagcgcccaa taattttgtt cgcgattggt tagagaaaag ctacactcaa       180
     tttatcgcta acattttgca agaaataact ggtcgcttat ttgatgtccg ctttattgat       240
     ggcgagcagg aagaaaactt tgaatacact gtgattaaac caaatccagc attagatgaa       300
     gatggcattg aaattggaaa acatatgctt aatccacgtt atgtttttga tacctttgtc       360
     attggttcag ggaacagatt tgcccacgca gcatcacttg cagtagccga agcaccagcg       420
     aaagcatata atccactctt catttatgga ggagttggcc tcggtaaaac acatttaatg       480
     cacgcagttg gccactatgt tcaacaacat aaagataatg cgaaagtaat gtacctttcc       540
     agcgaaaaat tcaccaatga gtttattagc tctattcgtg ataataaaac cgaagaattt       600
     cgcacaaaat atcggaatgt tgatgtctta cttattgatg atattcaatt tttagccggt       660
     aaagaaggaa cacaagagga atttttccat acatttaaca cactttatga tgaacaaaag       720
     caaattatta tttccagtga ccgaccacca aaagaaattc ctacactgga agatcgactg       780
     agatcccgct ttgaatgggg cttaattact gatattacgc caccagactt agaaacccgg       840
     atcgccattt tacgtaaaaa agcaaaagca gacggattag atattccaaa tgaagttatg       900
     ctttatatcg caaaccaaat tgattcgaat attcgcgagc tagaaggcgc tctcatccga       960
     gtagttgctt attcttccct cgttaataaa gatataacag ctggtcttgc agcagaagca      1020
     ctaaaagata ttatcccctc ttctaaatca caagttatta ctattagtgg tattcaagaa      1080
     gcagtcggtg aatatttcca cgttcgttta gaagatttta aagcaaaaaa acggacgaaa      1140
     agtatagcat tcccgcgcca aatcgccatg tatctctcaa gagagcttac agatgcctca      1200
     ttaccaaaaa tcggtgatga atttggtggt cgagatcata caacagttat tcatgcacat      1260
     gaaaaaatat cgcaactact aaaaaccgat caagtgttga aaaatgacct tgccgaaatt      1320
     gaaaaaaatt taagaaaagc acaaaatatg ttttaa                                1356
//

If you have problems or comments...

PBIL Back to PBIL home page