(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAA

AL591973.LMAA        Location/Qualifiers
FT   CDS_pept        123200..123712
FT                   /transl_table=11
FT                   /gene="lmaA"
FT                   /product="antigen A"
FT                   /db_xref="InterPro:IPR011855"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP93"
FT                   /protein_id="CAC98333.1"
FT                   /translation="MAFEENLYCDYTPGAAKAVAGKDVILAVFNAAGDKLLAVAGQQGL
FT                   TVNRSKDSIEITSKDTVGGWKSKIGGMKEWSIENDGLYVADAESHKELAKYFESDSPVC
FT                   VKIINQASKKGLFGGLAIVADYSFEAPFDEAMTYSVKLDGMGALVDLTITEGGDQMPGE
FT                   TPVAPAE"
     atggcatttg aagagaattt atattgtgat tatacaccgg gagctgctaa agcggtcgcg        60
     gggaaagatg taattttagc agtttttaac gcagcggggg acaaactatt agcggttgcg       120
     ggccaacaag gtctaactgt aaaccgttct aaagatagca ttgaaattac atctaaagat       180
     acagttggcg gatggaaatc caaaattggc ggtatgaaag aatggtcaat tgaaaatgac       240
     ggattatatg tcgctgatgc agagtctcac aaagaattgg cgaaatattt cgaaagtgat       300
     agcccggttt gtgtgaaaat cattaatcaa gcatctaaaa aaggtctttt cggtggtttg       360
     gcaattgtag ctgactatag ttttgaagca ccttttgacg aagcgatgac ttactctgta       420
     aaactagacg gaatgggcgc gcttgttgat ttaacgatta ctgagggcgg cgaccaaatg       480
     cccggcgaaa cacctgtagc accagcagaa taa                                    513
//

If you have problems or comments...

PBIL Back to PBIL home page