(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAB

AL591973.LMAB        Location/Qualifiers
FT   CDS_pept        122798..123187
FT                   /transl_table=11
FT                   /gene="lmaB"
FT                   /product="antigen B"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP94"
FT                   /protein_id="CAC98332.1"
FT                   /translation="MKSLSFMRVLEAVRTMLQEKGGLDISIVMRDQVEMPTTMIEMIDQ
FT                   EEEESQTAWKEKYRFAIHHYTNETDLAGVEKIDTLIQTGFTLPEGYKLIAVRHYGKQNL
FT                   VKENTLIHAKTSFEVSICRELKVKI"
     gtgaagagtt tgagcttcat gagagttttg gaagcagtga gaacaatgct ccaggaaaaa        60
     ggcggactag atatttctat tgtaatgcgt gaccaagtgg aaatgcctac aacgatgatc       120
     gagatgattg atcaagagga agaagaaagc caaactgcct ggaaagaaaa ataccgtttt       180
     gcaatccatc attatacaaa tgaaacggac ttagcgggag tcgaaaagat agatacgctt       240
     atccaaacag gattcacttt gcctgaagga tacaaattaa tcgctgttcg acattacgga       300
     aaacaaaatt tagtcaaaga aaatacgtta attcacgcaa aaaccagttt tgaagtaagt       360
     atttgtcgtg aattaaaagt aaaaatttag                                        390
//

If you have problems or comments...

PBIL Back to PBIL home page