(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMAD

AL591973.LMAD        Location/Qualifiers
FT   CDS_pept        121664..122092
FT                   /transl_table=11
FT                   /gene="lmaD"
FT                   /note="similar to Antigen D"
FT                   /db_xref="UniProtKB/TrEMBL:Q7AP96"
FT                   /protein_id="CAC98330.1"
FT                   /translation="MDRKLLKEKQIQLIFQLEQEENRFIRKRLIEELEFFEALGDREKG
FT                   LLTAEQKLLILTPSEYREYKRTKSDVQISRIIGVSRSSLAEWKRKKGLNRKKSQPVQQE
FT                   MIDVLAFHLDKTKEEIGALPASAIECQYEAFVINEANN"
     atggatagaa aacttttaaa agaaaagcaa atccaactaa tttttcaact agaacaagaa        60
     gaaaatcgat ttattcgaaa gcgtttgata gaagagttgg agttttttga agcacttggg       120
     gatagggaaa aaggacttct aacggcggag caaaagttgc ttattttaac acctagtgag       180
     taccgagaat acaaaagaac caaatcagat gtgcaaatta gtaggataat tggagtatcg       240
     agatcgtcac ttgcagaatg gaaacgaaaa aaaggtttaa atagaaaaaa gtcgcaaccg       300
     gttcagcagg aaatgattga tgtattagct tttcatttag ataaaacaaa agaagaaatt       360
     ggcgctttac ctgcttcggc gattgaatgt cagtatgagg cttttgtgat taatgaagcc       420
     aataattaa                                                               429
//

If you have problems or comments...

PBIL Back to PBIL home page