(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0003

AL591973.LMO0003     Location/Qualifiers
FT   CDS_pept        3121..4464
FT                   /transl_table=11
FT                   /gene="lmo0003"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAW0"
FT                   /db_xref="InterPro:IPR002528"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAW0"
FT                   /protein_id="CAC98218.1"
FT                   /translation="MMKDMTTGNPTKLIFLFAMPMLIGNLFQQFYTMIDAVIVGKFVSV
FT                   DALAAVGATNSVNFFMISLIIGLMSGISVVVAQYFGFKDYDRLKDVIATATYAVVFSAI
FT                   ILTVAGVLLAKPLLILLRTPANILDDSTIFLTTLFIGILPMSLYNGMAAILRALGNSIT
FT                   PLIFLILSSLMNIALDFLFVVYMDMGVRGAAIATVLSQTAAAIAVIYYAYRHVPFMRIE
FT                   RAKFKLSTPLLKEMVRIGLPSGLQGSFISIGNMALQSLINGFGSSVVAAYTAASRIDSL
FT                   TYQPGIAFGAASSMFAGQNIGAGKIDRVREGFWSGIKVVTAISIGITILVQLFARQFLL
FT                   LFVDSSETEVINIGVSYLLIVSLFYVVVGILFVVRETLRGTGDAMVPLAMGIFELVSRL
FT                   VIGFVLSLYIGYVGLWWATPVAWITATILGVWRYKSGAWQKKAVIRRK"
     atgatgaaag atatgacaac aggtaatccg acaaaattaa tttttttatt cgcgatgccg        60
     atgttgattg gaaacttatt tcagcaattt tatacgatga ttgatgcggt tattgttggg       120
     aaatttgtaa gtgtagatgc gctagctgct gttggagcga caaattcggt caattttttt       180
     atgatttctt tgattattgg acttatgagt gggatttctg tcgtagttgc gcagtatttt       240
     ggatttaaag attatgatcg tttgaaagat gttattgcta cggcgactta tgcggtggtt       300
     ttttcggcga ttattttgac ggttgcgggc gttttacttg cgaagccact tcttattttg       360
     ttacgaacac cggcaaatat tttggatgat tctactatct ttttaaccac cctttttatc       420
     gggattttgc cgatgagtct gtataacggg atggccgcga tacttcgagc tcttggaaat       480
     tcgattaccc cactgatttt tttgatttta tcgtctttaa tgaatattgc attagatttt       540
     ttatttgttg tttatatgga tatgggcgtt cgcggggctg ctattgcgac agttttatcc       600
     caaacagctg cagcgattgc tgttatttac tatgcttatc gtcacgtacc atttatgcgg       660
     atagagcgtg caaaattcaa gctctccacc ccactcctta aagaaatggt gcgcattggg       720
     ctgccttctg gattacaagg atcctttatt tctatcggaa atatggctct tcaaagttta       780
     ataaatggat tcggttcatc ggtcgttgcg gcttatacgg cggcgagtcg aattgattca       840
     cttacatatc aaccaggaat tgcttttgga gcagcttcct ccatgtttgc tggtcaaaat       900
     atcggtgctg gaaaaattga ccgcgttcgc gaaggttttt ggtcgggaat taaagtcgtt       960
     acagctatca gtattggaat cacaatttta gttcaacttt tcgctaggca gtttttatta      1020
     ctatttgtag attctagtga gacggaagtt attaatattg gtgtgagtta tttacttatt      1080
     gtctctttat tttatgtcgt agttggaatt ttatttgttg ttcgggaaac tttgcgaggt      1140
     actggagatg cgatggttcc tttagcgatg gggatttttg agttggtttc gagacttgtt      1200
     atcggatttg ttttgtcgct ttatattgga tacgtagggc tttggtgggc tacaccggtt      1260
     gcatggataa ccgcaacgat actcggcgtt tggagatata aatcaggagc atggcaaaaa      1320
     aaggcagtta ttcgacgaaa ataa                                             1344
//

If you have problems or comments...

PBIL Back to PBIL home page