(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0017

AL591973.LMO0017     Location/Qualifiers
FT   CDS_pept        complement(20308..21426)
FT                   /transl_table=11
FT                   /gene="lmo0017"
FT                   /note="similar to Bacillus anthracis CapA protein
FT                   (polyglutamate capsule biosynthesis)"
FT                   /db_xref="GOA:Q8YAU6"
FT                   /db_xref="InterPro:IPR019079"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAU6"
FT                   /protein_id="CAC98232.1"
FT                   /translation="MKSRKKGIILVLSVILIFSIGLLVNNLMTNNKDTAKPKKKTVAAV
FT                   KKKKETPPKPKEPFNIDFTGDIMFDWDLRPVLAEKGMDYPFNNVREELKSSDYTFVDLE
FT                   TAITTRTKKVPYQEFWIKSDPSSLTALKNAGVDMVNISNNHILDYYEDGLLDTTAALRA
FT                   NNLAYVGAGKNEDEAYQLKVADIKGNKVGFMSFCHFFPNTGWIADEDTPGVTNGYDLNL
FT                   VEEKIKEERAKNKDIDYMVVYFHWGVEKTNTPVDYQTQYVKKLVDDNLVDAIVASHPHW
FT                   LQGFEVYKDVPIAYSLGNFLFPDYVSGHSAETGIYKLNFDQGKVTAHFDPGIISGNQIN
FT                   MLEGSSKTAQLNYLQSISPNATINSNGDISAK"
     atgaaatcaa gaaaaaaagg gattatctta gtactgtccg ttattctaat cttttccatt        60
     ggtttattag tgaacaacct catgacaaac aacaaagata ctgctaagcc aaaaaagaaa       120
     accgtcgctg ctgttaaaaa gaaaaaagag acacctccaa aaccaaaaga accatttaac       180
     attgatttta caggtgatat tatgtttgat tgggatttac gccccgtttt agcagagaag       240
     ggaatggatt atccttttaa taatgttcgc gaggaactga aatcgagcga ctatacattt       300
     gttgatttag aaacagctat tacaactcga acaaaaaaag tcccctacca agaattttgg       360
     attaaaagtg atcctagttc tttaacagct cttaaaaatg caggggttga tatggttaat       420
     attagtaata accacatttt agactattac gaagatggat tactcgacac aacggctgct       480
     ttacgcgcca ataacctagc ctatgttggc gccggtaaaa atgaagatga agcctatcaa       540
     cttaaagttg ctgacatcaa aggaaacaaa gttggtttca tgtcgttttg ccactttttc       600
     ccgaatacgg gttggattgc cgacgaagat actccagggg ttactaatgg ttatgattta       660
     aaccttgtcg aagaaaaaat caaagaagaa cgcgcaaaaa ataaagatat tgattatatg       720
     gtcgtctatt ttcactgggg agttgaaaag acgaatacac ctgtagatta tcaaacccaa       780
     tacgttaaaa aactcgtgga tgataattta gtggatgcga ttgttgctag ccatccacac       840
     tggctccaag gttttgaagt atacaaagat gttccaattg cttattcatt aggtaatttc       900
     ttattccctg actatgtttc aggtcattcg gcagaaacag gtatttataa actgaatttt       960
     gatcaaggta aagtaactgc ccattttgat cctggtatta tttcaggcaa tcaaattaat      1020
     atgcttgaag gttcttccaa gacagcacaa ttaaattacc tgcaatccat ttctccaaat      1080
     gcaaccatta atagtaatgg tgatatttcc gcaaaataa                             1119
//

If you have problems or comments...

PBIL Back to PBIL home page