(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0026

AL591973.LMO0026     Location/Qualifiers
FT   CDS_pept        28254..28895
FT                   /transl_table=11
FT                   /gene="lmo0026"
FT                   /note="similar to E. coli copper homeostasis protein CutC"
FT                   /db_xref="GOA:Q8YAT7"
FT                   /db_xref="InterPro:IPR005627"
FT                   /db_xref="InterPro:IPR023648"
FT                   /db_xref="InterPro:IPR036822"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT7"
FT                   /protein_id="CAC98241.1"
FT                   /translation="MILKEVCIENTTNLVNVIEAGANRVELCDNLAEGGTSVSYGVAKH
FT                   VVKICHEQNVSVMAMVRPRKGNFVYTKEEISVMIDDILMYKKIAVDGVVFGCITDSGLL
FT                   DKPAINELLKAAAGLEVTFHMAFDELVETEKLSAIDWLVEQGVTRILTHGGDGAKLPEE
FT                   TFVQWRKYIDYAAGRIIILPGGGIKSHNLEWIIKETGAAEIHGTDLFGER"
     atgattttaa aagaagtctg tattgaaaat actactaatt tggtgaacgt tattgaagct        60
     ggagctaatc gagttgagct ttgtgataat ctagcggagg gcggaacttc tgttagttat       120
     ggggttgcga aacatgttgt gaaaatttgt catgaacaaa atgtaagtgt aatggcaatg       180
     gtccgtcccc gaaaaggcaa ttttgtttat acaaaagaag aaatttcggt tatgattgat       240
     gacattttga tgtacaagaa aatagcggtt gatggcgtgg tttttggctg tattacggat       300
     tctggattgc tagataaacc agccataaat gaattattga aagctgcagc aggtctggaa       360
     gtgacttttc atatggcgtt tgatgagtta gtagaaacag aaaaattatc ggcaatagac       420
     tggttagttg agcaaggcgt tacaagaatt ctcacgcatg gtggtgacgg cgctaaactt       480
     cccgaagaaa cttttgttca atggcgaaaa tatattgatt acgcagcggg tcgaatcatt       540
     attttaccag gtggaggaat taaatcgcac aatttagaat ggattataaa agaaactgga       600
     gcagctgaaa tacatggcac tgacttgttt ggggagcgct aa                          642
//

If you have problems or comments...

PBIL Back to PBIL home page