(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0028

AL591973.LMO0028     Location/Qualifiers
FT   CDS_pept        31088..31963
FT                   /transl_table=11
FT                   /gene="lmo0028"
FT                   /note="similar to E. coli microcin C7 self-immunity protein
FT                   (MccF)"
FT                   /db_xref="InterPro:IPR003507"
FT                   /db_xref="InterPro:IPR027461"
FT                   /db_xref="InterPro:IPR027478"
FT                   /db_xref="InterPro:IPR029062"
FT                   /db_xref="InterPro:IPR040449"
FT                   /db_xref="InterPro:IPR040921"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT5"
FT                   /protein_id="CAC98243.1"
FT                   /translation="MLVKGDTVGIICCSDGRKKEDENRIALLEQVLKTEFSLQVVFAET
FT                   IFQKAESPFSGTPQARAIELMKLYQRSDVQMIFDISGGDAANQVLPYLDFDIIRNAQKP
FT                   FVGYSDLTVILNAIYTKTEQMGYNYQLLHLVGKDSELQQSHFRKTFFENRVLISGEQLN
FT                   EFVWRGGEVIGGNIRCFLKLAGTNFMPDFTNKIILLESLGGKEAKLASYVAQLEQLGAF
FT                   SKCLGVIVGQHSEAEENGEYERIGRLYQQIGRKYKLPIFRTSEIGHSVDAKPCLIGAKV
FT                   NVSRETLTNF"
     atgctagtaa aaggcgatac agtgggaatt atttgttgtt ctgatggtcg gaaaaaagaa        60
     gatgagaaca gaattgcact gcttgagcaa gtgctaaaaa cagaatttag cttgcaagta       120
     gtttttgctg aaactatttt tcaaaaagct gaatcgccat ttagtggtac tccgcaagct       180
     cgtgcgatag aactgatgaa attataccag cgttcagatg tgcaaatgat ttttgatatt       240
     tctggtggag atgcagccaa tcaagtattg ccttatcttg attttgatat tatccgaaat       300
     gcgcaaaaac cgtttgttgg ctatagtgat ctaacggtga ttttgaatgc tatttatacg       360
     aaaacagaac aaatgggtta taattatcaa ttacttcatt tagtcggtaa agatagtgag       420
     ttacagcaga gtcattttag aaaaacattt tttgaaaatc gtgtattaat tagcggagag       480
     cagcttaatg agtttgtgtg gcgtggtggc gaagttattg gaggaaacat tcgttgcttt       540
     ttaaagttag caggaacaaa ttttatgcct gatttcacta ataaaataat tttgttagaa       600
     agtctcggtg ggaaagaggc gaagcttgcc tcatatgtgg ctcaattaga gcaattagga       660
     gcgttttcta aatgtttagg cgttattgtg ggacaacatt ccgaagcgga ggaaaacggt       720
     gaatatgaaa gaattggtcg cttatatcaa caaattggtc ggaagtataa gttgccgatt       780
     ttccgaacaa gcgaaatagg gcatagtgta gatgcaaaac catgcttaat tggtgcaaaa       840
     gttaatgttt cacgtgaaac attaacaaat ttttaa                                 876
//

If you have problems or comments...

PBIL Back to PBIL home page