(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0030

AL591973.LMO0030     Location/Qualifiers
FT   CDS_pept        complement(32571..33380)
FT                   /transl_table=11
FT                   /gene="lmo0030"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAT3"
FT                   /db_xref="InterPro:IPR000150"
FT                   /db_xref="InterPro:IPR006379"
FT                   /db_xref="InterPro:IPR023214"
FT                   /db_xref="InterPro:IPR036412"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAT3"
FT                   /protein_id="CAC98245.1"
FT                   /translation="MEKYLICSDLDGTLLLKNQTISPKTLNLLQQLIEEGHHFAVSTGR
FT                   MYNSATDFAKLVHPKADVIASNGGVVAVSGEIIQQEKMKQSALLETFLLCQNHDLPVFF
FT                   FSTDTVFYTKNPPYYFTDEEDKGRVNATKLVAIKSREIFLEHADQFINGIVIEEEDFDK
FT                   LAVLRSDLEKLSDVSILSSHANNIEILPKDMDKKYAVKNLAAHLNIKPENVITFGDGEN
FT                   DIGMLEVAGAGVAMENASELVKKSADFVTTANDADGIYYFLKKHLNR"
     ttggaaaaat acttaatttg ttctgattta gatggaacat tactgctaaa aaatcaaact        60
     atctcaccaa aaacactaaa tttattgcaa caactaatag aagaaggtca ccattttgcc       120
     gtttccactg gtcgaatgta caattccgca acagacttcg ccaaacttgt tcatccaaaa       180
     gcagatgtca ttgcctcaaa cggcggtgtg gtcgcagtat ccggcgaaat cattcaacaa       240
     gaaaaaatga aacaatctgc gttactcgag acatttttat tatgccaaaa tcatgattta       300
     ccagtatttt tcttttcaac agatacagtt ttctacacta aaaatccacc atattatttt       360
     acggatgaag aagataaagg ccgagtaaac gccacaaaac tcgtagcgat taaatcaaga       420
     gaaattttcc ttgagcatgc ggaccagttc attaatggta tcgtaatcga ggaagaagat       480
     ttcgacaaac tcgcagtcct tcgcagtgat ctagaaaaac tctccgatgt ttctatcctt       540
     tcttcccatg ccaataatat tgaaatctta ccaaaagata tggataaaaa atatgccgtg       600
     aaaaatctcg cggcacattt aaatatcaag ccagaaaatg tgattacttt tggtgatggt       660
     gaaaatgata ttgggatgct tgaagtagct ggtgcagggg ttgcgatgga aaatgcgagt       720
     gaactagtga aaaaaagtgc tgattttgtt actactgcaa atgatgccga tggaatttac       780
     tactttttga aaaaacatct taatcgttaa                                        810
//

If you have problems or comments...

PBIL Back to PBIL home page