(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0035

AL591973.LMO0035     Location/Qualifiers
FT   CDS_pept        39385..40470
FT                   /transl_table=11
FT                   /gene="lmo0035"
FT                   /note="similar to Glucosamine--fructose-6-phosphate
FT                   aminotransferase (C-terminal domain)"
FT                   /db_xref="GOA:Q8YAS8"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR035466"
FT                   /db_xref="InterPro:IPR035490"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS8"
FT                   /protein_id="CAC98250.1"
FT                   /translation="MKPTMMTYINEEEEMCRAILANFQTNAEKLESLVKNGAKEWLILA
FT                   TGSSLNAAQSAKYYIENIADVRITVEEPFNHLYYEKLSNHLDLVIGISQSGQSTSTISA
FT                   LERVKKEASVPVVALTSDVTSEIAEFADITLDIGSGKERVGYVTKGFTATVLTLMLTGL
FT                   HFAYKTAQIDETKFNNEINAFSRATNAIPATIAETEAFYERWQEEFATAPKFTAIGYGP
FT                   TVGTCKEFETKFSETVRVPSQGLDLEAFMHGPYLEVNPQHRIFFLETESAVTERLVALR
FT                   NYESKYTPFTYTVKFGTAGNDRTLLIPADLDEYQAPFLMILPFQILAHHIAELKGNKLT
FT                   ERIYTDFGVAMKSKTKPGDYA"
     atgaaaccaa caatgatgac ttatattaat gaagaagagg aaatgtgtcg agcgatttta        60
     gccaatttcc aaacaaatgc agaaaaatta gaatcactcg taaaaaatgg cgcaaaagaa       120
     tggttaattt tagcaactgg atcaagctta aatgcagctc aaagcgccaa atattacatt       180
     gaaaatatcg cagatgtccg tattactgtt gaagaacctt tcaaccatct atattacgaa       240
     aaactatcaa accacctaga tctagtcatc ggaatttcgc aaagcggtca aagcacatcg       300
     actatttctg cgctagaacg agtgaaaaaa gaagcttccg ttccagtagt cgccctaact       360
     agtgatgtaa cgagtgaaat tgctgaattt gcggatatta cgcttgatat cggctccgga       420
     aaagaacgag ttggctacgt aacaaaaggt tttacagcaa cagttctaac attaatgctg       480
     acaggacttc attttgcata caaaacagca caaattgatg aaaccaagtt caataatgaa       540
     atcaatgcat ttagccgagc aaccaacgca atcccagcaa caattgccga aacagaagca       600
     ttttatgaaa gatggcaaga ggaattcgct actgcaccga agtttacagc aattggatat       660
     ggtcctactg ttggaacgtg caaagaattt gaaacaaaat tctcagaaac tgtccgcgtg       720
     ccatcacaag gtcttgattt agaagcgttt atgcatgggc catatttaga agtaaatcca       780
     cagcatagaa tcttcttttt agaaacagaa agcgccgtta ccgaacgatt agtagcgttg       840
     cgcaattatg aatctaaata tacaccgttt acgtatacag ttaaatttgg tacagctgga       900
     aatgaccgaa cgctattgat accagcagat ttagacgaat accaagcgcc gttcctaatg       960
     attcttcctt tccaaatttt agcgcatcat attgcggagt tgaagggaaa taaattaaca      1020
     gaacgtatct acacggactt tggcgtagcg atgaagagta aaacaaaacc aggtgactat      1080
     gcataa                                                                 1086
//

If you have problems or comments...

PBIL Back to PBIL home page