(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0038

AL591973.LMO0038     Location/Qualifiers
FT   CDS_pept        43175..44266
FT                   /transl_table=11
FT                   /gene="lmo0038"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS5"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS5"
FT                   /protein_id="CAC98253.1"
FT                   /translation="MRTIDSSSKKDGFRMPGEFEKHAGCYIIWPERPDNWRLGAKPAQK
FT                   AFVDVATAISHFEPVTVVASSSQYVNARYMLSDEIRVVEMDNDDAWVRDSGPTFVVNDS
FT                   GDVRGVDWSFNSWGGLVDGLYFPWDKDDQVAQKICELERKDRYRLADFVLEGGSIHVDG
FT                   EGTLVTTEECLLSEGRNPQLSKQQIEMVLKEYLNLEKIIWLKRGIYLDETNGHVDNIFN
FT                   YVRPGVVALAWTDDETDPQYEISKECFDILSNETDAKGRKLEVHKINVPKPILITDEES
FT                   KGVDAVEGTLPREEGDRLAASYINYYTANGGVIFPLFGDPNDELAREKLQQLYPNCEVV
FT                   GVKAREILLGGGNIHCITQQVPR"
     atgagaacga ttgatagttc ttctaaaaaa gatggattta gaatgcctgg ggaatttgaa        60
     aaacacgctg gttgctatat tatttggcca gaacgaccag ataattggcg cttaggggcc       120
     aaacctgcgc aaaaagcttt tgttgatgtg gcaacagcga tttctcattt tgaaccagtt       180
     actgttgttg caagttctag tcaatatgta aatgcgagat atatgttgtc tgatgaaatt       240
     cgcgtagtgg aaatggataa cgacgatgct tgggtgcgcg attctgggcc aacttttgtt       300
     gttaatgatt ctggtgacgt acgtggagtg gattggtcat ttaactcttg ggggggattg       360
     gtcgatggtt tgtacttccc gtgggataaa gatgatcaag tcgctcaaaa aatatgcgaa       420
     ttagagcgaa aagatcgtta tcgcttagct gattttgtgt tagaaggagg ttccattcat       480
     gtcgacggtg aaggcacgct tgtaacgaca gaagaatgct tattatcaga aggtcgcaat       540
     ccacaacttt caaaacagca aatcgaaatg gttttaaaag agtatttaaa tttagaaaaa       600
     attatttggt taaaacgagg aatttattta gatgaaacga atggtcatgt agataatatt       660
     ttcaattatg tacgcccagg tgtagtagcg cttgcgtgga cagatgatga aactgatccg       720
     cagtatgaaa tttccaaaga atgctttgat attttatcga atgaaaccga tgcaaaaggt       780
     cgcaaattag aagtgcataa aataaatgta ccaaaaccaa ttttaattac cgatgaagaa       840
     agtaaaggtg tagatgctgt ggaaggaacg ctaccaaggg aagaaggcga ccgactcgca       900
     gcaagttata ttaattacta cacagccaat ggtggagtga tttttccgct atttggggat       960
     ccaaatgatg aacttgctcg cgaaaaatta caacaacttt atccaaactg tgaagtggtt      1020
     ggtgtaaaag caagagaaat tttacttggc ggcggaaata ttcactgtat tactcaacag      1080
     gtgccaagat ga                                                          1092
//

If you have problems or comments...

PBIL Back to PBIL home page