(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0039

AL591973.LMO0039     Location/Qualifiers
FT   CDS_pept        44282..45223
FT                   /transl_table=11
FT                   /gene="lmo0039"
FT                   /note="similar to carbamate kinase"
FT                   /db_xref="GOA:Q8YAS4"
FT                   /db_xref="InterPro:IPR001048"
FT                   /db_xref="InterPro:IPR003964"
FT                   /db_xref="InterPro:IPR036393"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS4"
FT                   /protein_id="CAC98254.1"
FT                   /translation="MNQKIVVALGGNAILSSDASAEAQRSALEETAEYLVQFIENGDDL
FT                   IISHGNGPQVGNLMLQQHAGASEKNPAMPLDTCVAMTQGSIGYWMQNALDKAFLKHGLD
FT                   KVAVSLITQVVVDKDDPAFEKPTKPIGPFLNKEEAEKEMAETGAIFLEDAGRGYRKVVP
FT                   SPRPLSIKEHQIIKQLVDSGVVTISAGGGGVSVVENGLDLSGVETVIDKDFASEKLAEL
FT                   IDADLLVILTGVENVYINYNQPNQKKLEQVTVSELEKYIDEKQFAAGSMLPKIEAATAF
FT                   VKERPHAKAIITSLENIGAMLERGAGTVIVAG"
     atgaatcaaa aaatagtcgt ggcacttggt ggaaatgcaa ttttatcgag tgatgccagt        60
     gctgaagcgc aacgaagtgc tcttgaagaa acagccgaat atttggtgca atttatcgaa       120
     aacggggatg atttaattat ttcgcatgga aatggaccgc aagtaggcaa cctgatgcta       180
     caacaacatg cgggagcttc tgaaaagaat ccagcaatgc cgcttgatac gtgtgtcgcg       240
     atgacgcaag ggagtattgg ctactggatg caaaatgcgc tagataaagc atttttaaaa       300
     cacgggctag ataaagtagc ggtttcatta attacacaag ttgttgtgga taaagatgat       360
     cctgcttttg aaaaaccaac caaaccaatt gggcctttcc ttaataaaga agaggctgaa       420
     aaggaaatgg cagaaactgg tgcaatcttt cttgaggatg ctggccgagg ttaccgtaaa       480
     gttgtcccat ctcctcgccc acttagtatt aaagaacatc agattattaa acaattggtt       540
     gatagtggcg ttgtgactat ttctgctggt ggaggtgggg tttcggtcgt tgaaaatggc       600
     cttgatttat ctggggtaga aaccgtaatc gataaagatt ttgcttctga aaaacttgca       660
     gaactaattg atgcagattt gttggttatt ttaacagggg tggaaaatgt ttatatcaat       720
     tataatcagc caaatcaaaa gaaacttgaa caagtgaccg tttcagaatt ggaaaaatat       780
     attgatgaga aacagtttgc agcaggaagt atgttgccca aaatcgaagc agcgacagct       840
     tttgtcaaag aaagaccaca tgccaaagca ataatcacat cgcttgaaaa tattggcgcc       900
     atgctagaac gtggggcagg aacagtgatt gttgcaggct ag                          942
//

If you have problems or comments...

PBIL Back to PBIL home page