(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0040

AL591973.LMO0040     Location/Qualifiers
FT   CDS_pept        45325..46434
FT                   /transl_table=11
FT                   /gene="lmo0040"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="GOA:Q8YAS3"
FT                   /db_xref="InterPro:IPR007466"
FT                   /db_xref="InterPro:IPR017754"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAS3"
FT                   /protein_id="CAC98255.1"
FT                   /translation="MGQLKGLPVEDGFRMPGEYEPHIGCFMIWPERPDNWRLGGKPAQQ
FT                   NYKEVAVAISNFEPVTMFVSPNQYKNARKELPDTIRVIEMSNDDAWIRDYGPSFLVDDK
FT                   GDMRGVDWGFNAWGGLLDGLYFPWDKDNQIAKKVCELERIDYYSQKDFILEGCSIHVDG
FT                   EGTLVTTEECLLSEGRNPNLTKIEIEQTLKKYFHAQKVIWLKHGFYLDETNGHVDNIFN
FT                   FVAPGEVVLSWTDNKSDPQYEISRECYDILANKTDAKGRTFIIHKLHCPDPVLITQTES
FT                   EGVEAINGTFPRQAGDRLAASYVNYYTANGAIIFPLFDDPKDKDAQELLEKLYPDRKIV
FT                   GIKAREILLGGGNIHCITQHLPDKSTIRE"
     atgggacaac tgaaagggtt gccggtagag gacggattca gaatgccagg agaatacgaa        60
     cctcatattg gctgtttcat gatttggccg gaaagacctg ataactggcg gcttggtggg       120
     aagccagcgc aacaaaacta taaagaagtt gcagtcgcta tttcaaattt tgagccagtc       180
     actatgtttg tatcaccaaa tcaatataaa aatgctcgta aagaacttcc ggataccatt       240
     cgtgttatcg aaatgagtaa tgatgatgcg tggatacgcg attatggacc tagttttttg       300
     gtggacgata agggagatat gcgcggcgtt gactgggggt ttaatgcttg gggtggtctt       360
     cttgatggtc tatattttcc gtgggataaa gataatcaaa ttgcaaaaaa agtttgtgag       420
     ttagagcgaa tcgactacta ttcacagaaa gattttattt tagaaggttg ttccattcat       480
     gtagacggtg aagggacact tgttacgaca gaagagtgcc ttttatcaga aggaaggaac       540
     ccgaatttaa ccaaaataga aatcgaacaa actttaaaaa aatatttcca tgcacaaaaa       600
     gtaatctggc ttaagcatgg cttctatctt gacgaaacaa acggacatgt agataacatt       660
     tttaactttg tggcacctgg agaagttgtt ttatcgtgga cggataacaa aagtgatccg       720
     cagtatgaaa tttcaagaga atgttatgat attttagcta acaaaacaga tgctaaggga       780
     agaactttta taatacataa actacattgt ccagatccag tacttattac gcaaacagag       840
     agcgaaggtg tggaagcgat taatggaact ttccctagac aggctggaga tcgattagct       900
     gctagttatg taaattacta tacagcgaat ggtgccatta ttttcccatt gtttgatgat       960
     ccaaaagata aagatgcgca ggaattactt gaaaagttat atcctgatag aaaaattgtg      1020
     gggattaaag cacgtgagat tttgctaggc ggcggaaata ttcactgtat cacgcaacat      1080
     ctccctgata aaagtacgat acgtgaataa                                       1110
//

If you have problems or comments...

PBIL Back to PBIL home page