(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0041

AL591973.LMO0041     Location/Qualifiers
FT   CDS_pept        46451..47230
FT                   /transl_table=11
FT                   /gene="lmo0041"
FT                   /note="conserved hypothetical protein, hypothetical
FT                   regulator"
FT                   /db_xref="GOA:Q8YAS2"
FT                   /db_xref="InterPro:IPR000281"
FT                   /db_xref="InterPro:IPR001347"
FT                   /db_xref="InterPro:IPR009057"
FT                   /db_xref="InterPro:IPR035472"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS2"
FT                   /protein_id="CAC98256.1"
FT                   /translation="MDFYEISSKTVASLTRNERILFDYVVKNMNLIKNQSIREVSAECF
FT                   VSTTTFLRFVRKLGFTGYSEFTTVLKFTLLGHTELKPSPFVVEQSDYREEYLKNIIESV
FT                   RVLEPSKIKKITKKLVNKPRIYFFAKGLSKHAAKYIKYLYTMSGFLVEFPEDYQYRQAV
FT                   LPHIGKDDLVFILTYGGHDIELIQTAQKLKSRNETPMLISITGADNNIIQNMSDINLYI
FT                   FTDEIEMNNLDITSRISTIAIMELILYQFMEDETSSF"
     atggactttt acgaaatttc cagtaagact gtagcttccc taactcgaaa tgagcgaatt        60
     ttatttgact atgtcgttaa gaatatgaat ttaattaaaa atcaaagcat tcgagaagtt       120
     tctgcagaat gctttgtttc aacaacaaca tttttgcgct ttgtaagaaa gcttggattt       180
     actggttata gcgagtttac aacggtctta aagttcactt tacttgggca tacagagcta       240
     aaaccgtccc catttgtcgt agaacagtcg gattatcgtg aagaatattt aaaaaacatt       300
     attgaatctg tccgagtttt agaaccaagt aaaatcaaga aaatcaccaa aaaactagta       360
     aacaaaccgc gaatttattt ttttgctaaa ggactgagca aacatgctgc gaaatacatc       420
     aaatatctct atacaatgag cggatttttg gtagagtttc ctgaagatta tcaatatcgc       480
     caagctgtat tgccgcatat tggtaaagat gatttagttt ttatccttac gtacggtgga       540
     catgatattg aattaatcca aactgcccaa aaactaaaaa gcagaaacga aacgcctatg       600
     ttgatttcga ttaccggggc tgataataac attattcaaa atatgagtga tattaattta       660
     tatattttta cagatgaaat tgaaatgaac aatttagaca tcacttctcg catctctaca       720
     attgcaatta tggagctaat cttataccag tttatggaag atgaaactag tagcttttaa       780
//

If you have problems or comments...

PBIL Back to PBIL home page