(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0042

AL591973.LMO0042     Location/Qualifiers
FT   CDS_pept        47335..47994
FT                   /transl_table=11
FT                   /gene="lmo0042"
FT                   /note="similar to E. coli DedA protein"
FT                   /db_xref="GOA:Q8YAS1"
FT                   /db_xref="InterPro:IPR032816"
FT                   /db_xref="InterPro:IPR032818"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAS1"
FT                   /protein_id="CAC98257.1"
FT                   /translation="MDFITYIIDFILHIDQHLVEIINNFGIWTYIILFLIVFIETGLVV
FT                   FPFLPGDSLLFAAGALSVLDGSILHIVPLIITLWLAAVLGDTVNYHIGKKIGTSIPEDS
FT                   WFGKLINKEKMEKAEAFFNKHGGKTIFIARFMPFIRTFAPFVAGASRMNYRYFLNYNIL
FT                   GATVWVLLCTLAGYFFGNFPIVKDNFSLVVIGIIVVSVIPMVVSFIKSKMDKKSAE"
     gtggatttta ttacctatat cattgatttt attttgcaca ttgaccaaca tttagtggag        60
     attataaata attttggaat ttggacttac atcattttat tcctgattgt atttatagag       120
     actggattgg tagtatttcc atttttacca ggagattcat tactattcgc agccggtgca       180
     ttatctgtat tagatggttc gattttacat attgttccgc taattattac tttatggtta       240
     gcagcagttc taggtgatac agtgaattat catatcggta aaaagattgg aacatccata       300
     ccagaagata gctggtttgg aaaactaata aataaagaaa aaatggaaaa agcggaggct       360
     ttcttcaata aacatggtgg gaaaacaatt tttattgcta gattcatgcc ttttattcgt       420
     acgttcgcgc catttgtagc tggagcaagc cgtatgaatt atcgctattt cttaaattat       480
     aatattttag gagcaacagt ctgggtattg ctttgcacgc ttgcaggata cttcttcggc       540
     aatttcccaa ttgttaaaga caacttctcg ttagtagtaa tcggaattat tgtagtttcc       600
     gttatcccaa tggttgtttc atttattaaa agtaaaatgg acaagaaaag cgcagaataa       660
//

If you have problems or comments...

PBIL Back to PBIL home page