(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0048

AL591973.LMO0048     Location/Qualifiers
FT   CDS_pept        51775..52389
FT                   /transl_table=11
FT                   /gene="lmo0048"
FT                   /note="similar to Staphylococcus two-component sensor
FT                   histidine kinase AgrB"
FT                   /db_xref="GOA:Q8YAR6"
FT                   /db_xref="InterPro:IPR006741"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAR6"
FT                   /protein_id="CAC98263.1"
FT                   /translation="MSNFTAKVPLSERMADVLISKDRWKDDEEGYLKVKYGLEIILINV
FT                   MKFALVYGIALVTGLLLQTVTVHLSYLWLRRYSFGLHATKTLNCTLISLLMFVLAPFVF
FT                   QNIPSNNWIVLGTFGFILLNMFLFAPADTESLPLIGEEHRKTLKRKAMIGTLILTGIAL
FT                   LIPFAEMKTLIMVGSLFQVISINPLTYKLLKRRYRNYEKYE"
     ttgagtaatt ttactgcaaa agtccctttg tcagaaagaa tggcggatgt gttgatttcg        60
     aaagaccgct ggaaagatga tgaagaaggt tatttaaaag taaaatatgg actggaaata       120
     attctaatta atgtcatgaa gtttgctctc gtatacggta tcgccttagt aacagggctt       180
     ttactgcaaa cagtgacagt gcatctgtca tatttatggc tcagacggta ttcttttgga       240
     ttacatgcaa ccaaaacatt gaattgcacg ttaattagct tattgatgtt tgtgcttgcg       300
     ccatttgttt ttcaaaatat cccctctaat aattggattg ttttaggtac atttggattt       360
     atactgctca acatgttttt attcgctccg gcagacacag aaagtttgcc tttaatcggt       420
     gaagaacacc ggaaaacact aaaaagaaaa gcgatgatag ggacgctaat tttaacggga       480
     attgcgttgc taataccatt cgcagagatg aaaacattaa tcatggtagg atctttgttt       540
     caggtgataa gtattaatcc acttacttac aaactattga aaaggaggta tcggaactat       600
     gaaaaatatg aataa                                                        615
//

If you have problems or comments...

PBIL Back to PBIL home page