(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0050

AL591973.LMO0050     Location/Qualifiers
FT   CDS_pept        52630..53925
FT                   /transl_table=11
FT                   /gene="lmo0050"
FT                   /note="similar to sensor histidine kinase (AgrC from
FT                   Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR5"
FT                   /db_xref="InterPro:IPR032834"
FT                   /db_xref="InterPro:IPR036890"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR5"
FT                   /protein_id="CAC98265.1"
FT                   /translation="MFSILMAIIQITGIFIAIQILTNKVFSIKEGLVTIAIAMLAFPLF
FT                   TLVQYWSMIFVLIVFVSALYWKNKNVVVSASITLVVIILLTISDSIVGFILVPGLNFKY
FT                   DEIFNELLPTLIYCAGMLANLLVFSFLLRKLIEKVNISRFVEHRKYAYIIFSIVALTVL
FT                   AFYMNIYAGSIAGFDGSVLKINTLIFTGYTILLIVIVTVVINTATNELKVQNQKEQLEQ
FT                   LQDYVTTLESLHREMRVFRHDYVNILSTLVGYIDNNDMPGLKYYFENNIVPINKTIESN
FT                   NYKISLLQNIHVIELKGLLAVKLIRAQELKIDAILEVVEPIDKISMDSIDLCKVVGILL
FT                   DNAVEAALTCENPVIRIAFVKKGDSIIIVFANSLPVNMPPIYKIFEEGFSTKGEGRGLG
FT                   LASLREIMKKYSHVALDTKVTDREVIQELEIM"
     atgtttagta ttttgatggc aattatacag ataacgggta tttttattgc aatccagatt        60
     ttaacaaaca aagttttttc aattaaagag ggattggtta ctatagcaat tgctatgcta       120
     gccttccctt tatttacttt agttcaatac tggtcgatga tttttgtatt gattgttttt       180
     gtaagtgcct tatattggaa aaataaaaat gtagtagttt cagcttctat tacgcttgtg       240
     gttattattt tacttactat tagtgactct atagtaggtt ttattttagt accgggcttg       300
     aactttaaat atgatgagat atttaatgaa ctgttaccaa cgttaattta ctgcgcggga       360
     atgttggcga atttgttggt attttcgttt cttcttagaa aattgattga aaaagttaat       420
     atttctagat ttgttgaaca tagaaaatat gcgtatatta ttttttctat cgttgctctt       480
     actgtcttag cgttctatat gaacatatac gcggggtcaa tcgcaggttt tgatggatca       540
     gttttgaaaa ttaatacgct tatttttaca ggatatacca ttttgttaat agttatagtg       600
     acggttgtta ttaatacggc aaccaacgaa cttaaagtac agaatcagaa ggaacagcta       660
     gaacagttac aggattatgt tactacatta gagtccctgc atagagaaat gcgcgttttt       720
     cgtcatgatt atgtgaatat cctgtcaaca cttgttggat atattgataa taatgatatg       780
     ccgggtttga agtattactt tgaaaataat attgtaccta taaataaaac aattgaatcg       840
     aacaactata agatttcatt gcttcaaaat attcatgtta ttgaactaaa gggcttgcta       900
     gctgttaaat taatacgagc tcaagagttg aaaattgatg caattttgga agtagttgaa       960
     ccgattgaca agatttcgat ggatagtata gatttatgca aagttgtcgg tattttgcta      1020
     gataatgcgg ttgaagcggc gttaacttgt gaaaatccag ttattcgaat cgcgtttgtg      1080
     aaaaaaggtg atagcataat tattgtattt gcgaatagtt taccagtaaa tatgccaccg      1140
     atttataaga tatttgaaga aggtttctct acaaaaggag aaggtcgtgg attaggcctt      1200
     gctagtttgc gggaaattat gaagaaatat tcgcacgttg ccttagatac gaaagtgacc      1260
     gatagagaag ttattcaaga attagaaatt atgtag                                1296
//

If you have problems or comments...

PBIL Back to PBIL home page