(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0051

AL591973.LMO0051     Location/Qualifiers
FT   CDS_pept        53944..54672
FT                   /transl_table=11
FT                   /gene="lmo0051"
FT                   /note="similar to 2-components response regulator protein
FT                   (AgrA from Staphylococcus)"
FT                   /db_xref="GOA:Q8YAR4"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR007492"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR4"
FT                   /protein_id="CAC98266.1"
FT                   /translation="MLPVFICEDNRMQRERLTKYIEDYIMVEHFDMKLELSTGDPFELV
FT                   SRMPTHQGMGLYFLDIDLGQPDMNGFELAQEIRKFDPRGFIIFITTHAELSYMTFTYKV
FT                   EALDYIIKDDIDLLHDRVLACMKQAEERISNDQDMQKYFTFKVSDKKIIHELLDDILFF
FT                   ETAPTIHKVILHGKNRQVEFYGKLKNIEKMLDESFYRCHRSYIVNKKNIHELDTTKGVV
FT                   KMSNGENCYASSKLIKSLSL"
     atgctaccgg tttttatttg tgaagataac agaatgcagc gagaaaggtt aacgaaatat        60
     attgaagact atattatggt tgaacatttt gatatgaagt tagaactttc aacaggagat       120
     ccgtttgagt tagtatcacg aatgcctaca catcaaggta tggggcttta ttttttagac       180
     attgatttgg ggcagccgga catgaatggt tttgaattag ctcaggaaat tcggaagttt       240
     gatccgcgtg gtttcattat ttttattaca acacatgcgg agttaagtta tatgactttc       300
     acgtataagg tggaagcgct tgattacatt attaaagacg atattgattt gctgcatgac       360
     cgggtacttg cctgtatgaa gcaagcagaa gaacggattt ccaatgatca agatatgcag       420
     aagtatttta cgtttaaagt gtcggataag aagattattc atgaactgtt agacgatatc       480
     ttgttttttg agacagcgcc aactattcat aaagtaattt tacatggcaa aaatcgccaa       540
     gtggaatttt atggtaagtt gaagaatatc gagaaaatgt tggacgaatc attttatcgg       600
     tgccacaggt cgtatattgt gaataagaaa aatattcatg agctagatac gacaaaaggt       660
     gtggtgaaga tgtctaacgg tgaaaattgt tatgcatcat cgaaattaat taaaagcttg       720
     agtttataa                                                               729
//

If you have problems or comments...

PBIL Back to PBIL home page