(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0052

AL591973.LMO0052     Location/Qualifiers
FT   CDS_pept        54839..56812
FT                   /transl_table=11
FT                   /gene="lmo0052"
FT                   /note="highly similar to B. subtilis YybT protein"
FT                   /db_xref="GOA:Q8YAR3"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001667"
FT                   /db_xref="InterPro:IPR003156"
FT                   /db_xref="InterPro:IPR014528"
FT                   /db_xref="InterPro:IPR038763"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR3"
FT                   /protein_id="CAC98267.1"
FT                   /translation="MSGYFQKRMLKYPLYGLIAATIILSVITFFFSWWLSALVVVGGII
FT                   LTVAMFYFEYRLNEDVQLYVSNLTYRIKRSEEEALVEMPMGILLYDEHYKIEWVNPFMS
FT                   KYFDKAELIGESLEEVGPEFLDVITGNDEKGIMSIAWRDHRFDTIVKRKERILYLYDRT
FT                   EYYDLNKKFQANKSVFAVIFLDNYDEWAQGMDDRRRSALNNLVTSMLTNWAREHRIYLK
FT                   RISTDRFMAFLTEEMLKRLEEEKFQILDRIRERTSKQNIPLTLSIGIGYKEDDLIQLAD
FT                   LAQSSLDLALGRGGDQVVIKQPEGKVRFYGGKTNPMEKRTRVRARVISQALQELITQSD
FT                   QVFVMGHRYPDMDVIGSSLGVMRIAEMNDRNAYVVVEPGKMSPDVKRLMNEIEEYPNVI
FT                   KNIVTPQVALENITEKSLLVVVDTHKPSMVINKELLDSATNVVVVDHHRRSEEFVGSPV
FT                   LVYIEPYASSTAELITELFEYQPDLEQVGKIEATALLSGIVVDTKNFTLRTGSRTFDAA
FT                   SYLRSLGADTILVQQFLKEDITTFTQRSRLVESLEIYHDGMAIATGHEDEEFGTVIAAQ
FT                   AADTMLSMEGVQASFVITLRPDKLIGISARSLGQINVQVIMEKLGGGGHLSNAATQLKD
FT                   VTIAEAEKQLISAIDAYWKGET"
     atgtcaggct attttcaaaa acgaatgctt aaatatccat tatacggtct gattgcagcg        60
     acaattattt tgagcgtaat cacgttcttt ttttcgtggt ggttatcggc gttagttgtt       120
     gttggcggaa ttattcttac ggttgcgatg ttttattttg aatatcgctt gaatgaagat       180
     gtgcaactat atgtttctaa tttaacgtat cggattaagc gtagtgaaga agaagcgctt       240
     gttgaaatgc cgatgggaat actgctgtat gatgaacatt acaaaatcga atgggttaac       300
     ccgtttatgt caaaatactt tgataaggca gagttaatcg gggaatcttt ggaagaagta       360
     ggaccggaat ttttggacgt tattactggg aatgatgaaa aggggattat gtcgattgct       420
     tggcgtgatc accgttttga tacgatagta aagcgtaagg aacgaatttt atatttatat       480
     gatcgcacag aatattatga tttaaacaag aaatttcaag cgaataaatc tgtatttgcg       540
     gttattttct tagataatta tgatgaatgg gcgcagggca tggatgatag acgtcgcagt       600
     gctttaaata atttggtgac gtcgatgttg accaactggg ccagggaaca tcgtatttat       660
     ttgaaacgga tttcgacaga ccgatttatg gcctttttga cggaggaaat gttgaagcgg       720
     ttggaggaag agaagtttca aatattggac cggattcgcg aacggacgtc gaagcaaaat       780
     attccattaa cgcttagtat tgggattggt tataaggaag atgatctgat tcagttggcg       840
     gatttggcgc agtcgagttt ggaccttgct ttagggcgcg gcggagatca ggtcgtaatt       900
     aagcaacctg aaggaaaagt gcgtttttac ggcggcaaaa caaacccgat ggaaaaacgg       960
     actcgggttc gcgcgcgtgt gatctcgcaa gccttgcaag agttgattac gcaaagtgac      1020
     caagtttttg ttatggggca ccgctatccg gatatggacg taattggttc gagtcttgga      1080
     gtgatgcgga ttgctgagat gaatgatcgg aatgcttatg tggttgtgga acctggcaaa      1140
     atgagtccag atgtgaagcg actaatgaat gaaattgaag aatatccgaa tgtaattaaa      1200
     aatattgtta caccgcaagt cgcactggaa aatatcacgg agaagagttt gctcgttgtt      1260
     gttgatacac acaaaccttc gatggttatt aataaggaat tgctggactc agctacgaat      1320
     gtggttgttg tcgatcatca ccgtcgttca gaggaatttg ttgggagtcc ggttcttgtt      1380
     tatatcgagc catatgcgtc atctactgcc gaattgatta cggagctatt tgagtatcaa      1440
     ccggatttag agcaggttgg gaaaatcgag gcaacggcgc ttctttccgg gattgtggtt      1500
     gatacgaaga actttacgct gcggactggg tcgcgaacgt ttgatgcggc aagttattta      1560
     cggtcgcttg gtgcggacac gattttggtg cagcaatttt tgaaagaaga tattactact      1620
     tttacacagc ggagtcgttt agtggagtcg cttgaaattt atcatgatgg tatggcgatt      1680
     gcgactggac atgaggacga ggaatttggc acagttatag ctgcgcaggc ggcagatacg      1740
     atgctttcga tggaaggcgt gcaggcatcc tttgttatta cgctacgtcc ggataaatta      1800
     atcgggatta gcgcgagatc gcttggccaa atcaatgtgc aagtcattat ggaaaaacta      1860
     ggcggtggcg gacatttatc gaatgcagcc acacagctta aagatgttac aattgcagaa      1920
     gcagaaaaac aattaattag cgccattgat gcgtattgga agggagaaac ataa            1974
//

If you have problems or comments...

PBIL Back to PBIL home page