(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0056

AL591973.LMO0056     Location/Qualifiers
FT   CDS_pept        60506..60799
FT                   /transl_table=11
FT                   /gene="lmo0056"
FT                   /note="similar to a small heat shock protein of Clostridium
FT                   acetobutylicum"
FT                   /db_xref="InterPro:IPR010310"
FT                   /db_xref="InterPro:IPR036689"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAR0"
FT                   /protein_id="CAC98271.1"
FT                   /translation="MSGQIRMSPSELRDRAKTYGQSGRDIEDILSRLSQLQEQLRSEWE
FT                   GQAFMRFDDQFEQLKPKVTEFANLMDQINDQLEKTANAVEEHDQQLSQNFGF"
     atgtcaggtc aaattcgtat gagtccaagc gaactacgtg atcgcgcgaa aacttacggt        60
     caaagtggtc gagatattga ggatattcta agtcgtttaa gtcaactaca agaacaacta       120
     cgtagcgaat gggaaggtca agcttttatg cgttttgatg atcaatttga acaattaaaa       180
     ccaaaagtaa ctgaattcgc aaacttaatg gatcaaatta acgatcaact tgagaagaca       240
     gcaaacgcag tagaagagca cgatcaacaa ctttctcaaa acttcggatt ctaa             294
//

If you have problems or comments...

PBIL Back to PBIL home page