(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0057

AL591973.LMO0057     Location/Qualifiers
FT   CDS_pept        60948..64154
FT                   /transl_table=11
FT                   /gene="lmo0057"
FT                   /note="similar to B. subtilis YueB protein"
FT                   /db_xref="GOA:Q8YAQ9"
FT                   /db_xref="InterPro:IPR023838"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ9"
FT                   /protein_id="CAC98272.1"
FT                   /translation="MKKVKWSILLFLVLAIFLSAGITYLALNQSSNKESKNNSEKTHKM
FT                   TIALVNEDQGDNFQGKQVEFGNQFVKSIEKDDTHEWYVVSRGVAESGLKRDVYNMMIVI
FT                   PSDFSEKAMSMTSSAPEKVTISYKVNDVGNSDLKAEAEKTAASVLEDFNSRIIDVYFAS
FT                   ILTTLQEAQDNIGTLVKEEKKYDAIYNKDVNNPLSSYTKQFKTVQDYTGTSKESFQGFQ
FT                   DIMKEFEESLNLSQKENEEHMKNMDAYTKTQEENAPFGAEFTENLSKFDGTLSAEDIRM
FT                   QTAALEQVNAKMTSEFQILENSNSLLSQTQALQSYIAETNARIDAVDAEIMGTLENDFR
FT                   TAVYNDLLRILQENEYSDKLNEIGLKDLTGEDINAGFNKMIVKEIQSLPTYNADQLASI
FT                   GLDEEMYKNVVTLSKEYYSNHRGAFSEGFSFTTDPKTLPTDTLKSDTINRLKSEGVALE
FT                   SSSYTVEGSDYPTEIILTLDENFTFSDVDCLVNGSSNPELVQQNAYGENGIKLSIQALG
FT                   STPAEIKITGKAKLREGVNVPLIGAVNWNATLQQYEKKEYSEMPTIPSELDPTTPDTSL
FT                   IVRKEPVPIKVTAPTYLNETKSSVKAITNTVKDYYKLQALFDLYYGIDASDSGQIPDFS
FT                   NYQVTLENSAKASSYYYIFNKEDVIGSFVNLTTDRFVADYTKKIKAFEKRIDDYKNTMA
FT                   EANSRSEDVTNRLNETTQEAINLNTNLALTLQNLESWREESKGLIEENGVVLEKSGEEA
FT                   TMALQLSSEFAGLLAESESLAGTSEGNLKSAEVVYKTFDAIDKEAKNIQQSGETLVKEA
FT                   STLSDDLSEKLEDDETFQKNFAKVMENSRVGDRQNENLYSFLSSPVDKMNAGTIVAGDK
FT                   SMPYFMILICTILAIFTSYVISHQEKKREQLNEFEKEMSLVFKNIPITFLAICVGIIEG
FT                   LIIGAISGFIFEVGEIGMFLWIGVCVLIMMTLVTAFSYLLRQFNMIGMSIILLVLSLYL
FT                   FLTDAVGLNIDNESIFATFRTFSPLQYMEYLLNGILSAQKDYIIVVYSLIGATVVFTGL
FT                   NLFVWHRSKEKVEEDDSDEI"
     atgaagaaag taaaatggag tattttactc tttttagtct tggcgatttt tctttcggca        60
     ggaattactt atttggcttt gaatcaaagt tcgaataaag agtctaaaaa taatagtgaa       120
     aaaacacaca agatgaccat cgcactcgtt aatgaggacc aaggagacaa cttccaagga       180
     aaacaagtag agtttggtaa tcaatttgtt aaaagtattg aaaaagatga tacgcatgaa       240
     tggtacgttg ttagccgcgg agttgcagaa agtggcttaa aacgagatgt atacaatatg       300
     atgatcgtta tcccgagtga cttttctgaa aaagcaatgt caatgacttc gagcgcccca       360
     gaaaaagtga caattagcta caaagttaac gatgtaggaa atagcgatct aaaagcggaa       420
     gccgaaaaaa cagcagcttc tgtattggaa gatttcaatt cacggattat tgatgtttat       480
     tttgcaagca ttttaacaac tttacaagaa gcgcaggata atattggaac cctagttaaa       540
     gaagagaaaa agtatgacgc tatctacaat aaagacgtaa ataatccgtt atccagctac       600
     acaaaacagt ttaaaacggt gcaagactac acaggaactt ctaaagagag cttccaaggt       660
     ttccaagata ttatgaaaga atttgaggaa agcctaaatc tctctcaaaa agaaaacgaa       720
     gaacatatga aaaacatgga tgcttataca aaaacacaag aggaaaatgc tccttttggg       780
     gcagaattca cagaaaactt gtcaaaattt gatggcactt tatcggcaga agatattcga       840
     atgcaaactg ccgctttaga acaagtcaat gcgaaaatga cttcagaatt tcaaatttta       900
     gaaaatagta attcattgtt atcacaaaca caggctttac agagctatat agctgaaacc       960
     aatgcacgga ttgatgcggt ggatgccgaa attatgggaa cgctcgaaaa tgattttcgg      1020
     acggctgttt ataatgactt gttgcgtatt ttacaagaaa acgagtactc ggataagttg      1080
     aatgaaattg gtcttaaaga tttgaccgga gaagatatta atgctggctt taacaaaatg      1140
     attgttaagg aaatacaatc attaccaaca tataatgcgg accaattagc atcgattggg      1200
     cttgatgaag agatgtacaa aaatgttgta acgctttcta aggaatatta tagtaaccat      1260
     cgcggtgctt ttagcgaagg ttttagcttt acgactgatc ctaaaactct accaactgac      1320
     acgctgaaaa gcgatacgat taatcgattg aaatccgaag gggtcgcgct agaaagcagt      1380
     tcctatacgg ttgaaggtag cgattatcca acagaaataa ttctaacttt agatgaaaat      1440
     ttcacttttt cagatgttga ttgtttggtt aatggaagca gtaatccaga gttagttcaa      1500
     caaaacgcat acggagaaaa tggcataaag cttagcatac aggcgcttgg aagtacaccg      1560
     gcagagatta aaatcaccgg aaaagcgaag ttgcgagaag gtgtgaatgt tccattaatt      1620
     ggtgctgtaa attggaatgc tacattgcaa caatatgaga aaaaagaata tagtgaaatg      1680
     ccaacaattc catcagagct tgatcctact accccggata cttcattaat agttagaaaa      1740
     gaacctgtac cgattaaggt cactgcacca acatatttga atgagacgaa gagttctgta      1800
     aaagcaatta ctaatacagt aaaagattac tataaactac aagcattatt tgatttatat      1860
     tacggaattg atgcgagtga ttctggacaa ataccggatt ttagtaatta tcaagtgacg      1920
     ctagaaaatt ctgcgaaagc atcctcgtat tattatattt ttaataaaga agatgtgatt      1980
     ggtagctttg taaatcttac tacagatcgg tttgtggcag attatacgaa aaaaattaaa      2040
     gcttttgaga agcgaattga tgactacaaa aatacaatgg ctgaggccaa ttccagatca      2100
     gaagacgtaa caaatagatt aaacgaaacg acgcaagaag ccattaattt aaatacaaat      2160
     ctagcgttaa cgttgcaaaa cctagaatct tggcgagagg aaagtaaagg tttaatagaa      2220
     gaaaatggcg ttgttttaga aaaatctggc gaagaagcca cgatggcact gcaattaagc      2280
     tctgaatttg ccgggctttt agcggaaagt gaatcgttag ctggtacttc tgaaggtaat      2340
     ttgaagtcag cggaagtcgt gtacaaaact tttgatgcga tcgataagga agccaagaat      2400
     attcaacaaa gcggagaaac tttagtaaaa gaagcctcca cactatccga tgatttaagc      2460
     gaaaaattgg aagacgacga aacgttccag aaaaatttcg ctaaggttat ggaaaatagc      2520
     cgtgttggtg atcgacaaaa tgaaaattta tatagtttct taagtagtcc ggtcgataag      2580
     atgaatgccg ggactattgt tgcgggtgac aaatcaatgc catacttcat gattttgatt      2640
     tgtacgattc tggcaatttt cactagctac gttatttcac accaagagaa aaaacgtgaa      2700
     caattaaatg aatttgagaa agaaatgtcg cttgtcttta aaaatattcc aattactttc      2760
     ctagcgatct gtgttgggat tattgagggg ctcataatag gcgccatttc aggatttatt      2820
     tttgaagttg gagaaattgg gatgttccta tggataggtg tctgcgttct aattatgatg      2880
     acgttagtta ctgctttttc atatttatta cgtcagttca acatgattgg gatgtcgatt      2940
     attttactcg ttttaagttt gtatctattc ttaacggatg cagttggact taacattgat      3000
     aatgaatcta ttttcgcgac gttcagaacg ttctcgccac ttcaatacat ggaatactta      3060
     ttgaatggga ttttgagtgc acagaaggat tatattattg tcgtatacag cttgattggc      3120
     gcgacagtag tatttactgg tctcaaccta tttgtctggc accgttctaa agaaaaagta      3180
     gaggaggacg attcagatga aatataa                                          3207
//

If you have problems or comments...

PBIL Back to PBIL home page