(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0059

AL591973.LMO0059     Location/Qualifiers
FT   CDS_pept        64677..64928
FT                   /transl_table=11
FT                   /gene="lmo0059"
FT                   /note="similar to B. subtilis YukD protein"
FT                   /db_xref="InterPro:IPR014921"
FT                   /db_xref="InterPro:IPR024962"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ7"
FT                   /protein_id="CAC98274.1"
FT                   /translation="MAKNTHMNVTVDFTNWGASKYDLRIPVHQPIKALIINLAETLKID
FT                   YKDLSKCTIKTTNKAILLSDDDKLTNFQIADGDILEIL"
     ttggctaaaa acacacatat gaatgtgaca gttgatttca ctaattgggg agcaagtaag        60
     tatgatttgc gaattccggt gcatcaacca atcaaagcat taattatcaa tttggcagaa       120
     acgctcaaaa tcgattacaa agatttgtcc aaatgtacga taaaaacaac gaataaagcg       180
     atattactaa gcgatgatga caaattgact aattttcaaa ttgcggacgg agacatttta       240
     gaaattttat ag                                                           252
//

If you have problems or comments...

PBIL Back to PBIL home page