(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0060

AL591973.LMO0060     Location/Qualifiers
FT   CDS_pept        64950..66146
FT                   /transl_table=11
FT                   /gene="lmo0060"
FT                   /note="similar to B. subtilis YukC protein"
FT                   /db_xref="GOA:Q8YAQ6"
FT                   /db_xref="InterPro:IPR018778"
FT                   /db_xref="InterPro:IPR042565"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAQ6"
FT                   /protein_id="CAC98275.1"
FT                   /translation="MNKTIEMDGTTYDFTYEDLVWSITFPKSKTRAKELAQLELLEKPA
FT                   THFTPAKISSDSDSYTISYEIAPRTYGFEQVRKMGREDKLRALRNIADLGELLNTRYTF
FT                   FLHPDNLIFDINLVPSIVHRGIKNILPPYELTEETFFKQYQCFVIAMFSKKFSFENLYN
FT                   GSLSGARGTQFEKSILDAKTVQDIATILEEAYMKEHAAVQKNMASVPKKKYSTFRGLAV
FT                   GFIIVAILLAIPVSYFAFVKVPLQNDLLTANENFLKTDYDKVITGLENVDPEKMPQSVQ
FT                   YELAYSYVKGEKMSDKKKENIMNTISLKSDAKNLLYWIYNGRGEFSKSLDIAKLLDDPT
FT                   LAMYSLTKQIEQVQSDTTLSGDEKVEKLKTLEESLKEYDEKVNESTTTEDETTNTEAK"
     atgaataaga caatagaaat ggacggaaca acttacgatt ttacttatga ggatctagtt        60
     tggagcatta cgtttccaaa atcaaaaaca cgcgctaaag aactcgcaca actagaacta       120
     ttagaaaaac ctgcgacaca ttttactcct gcgaaaattt cgagtgatag cgattcatat       180
     acgatttctt atgagattgc gccacgtact tatggatttg aacaagttcg aaaaatggga       240
     cgtgaagata aactgcgcgc actgcggaat attgcggatt taggcgaatt gttaaacacg       300
     cgctatacat tctttttaca cccggataat ctgattttcg atattaacct agtgccaagt       360
     attgttcatc ggggcattaa aaatatatta ccgccttatg aactaacaga agaaactttt       420
     ttcaaacaat atcaatgttt cgttattgcg atgttttcta agaaattctc ttttgaaaac       480
     ttgtacaatg gctcgctatc aggggctaga ggaacgcaat ttgagaagag tatattagat       540
     gcaaaaacgg tgcaagatat tgctactatt ttagaagaag catacatgaa agaacatgcg       600
     gcggttcaaa aaaatatggc aagcgtaccg aagaaaaaat acagtacttt ccgtgggtta       660
     gcggttggtt tcattatcgt cgctatttta cttgcaattc cagtaagtta ttttgcattc       720
     gttaaagtcc ctttacaaaa tgatttatta acagcaaacg agaatttcct gaagacagat       780
     tacgataaag tgattacagg tctagaaaat gtggatccag aaaaaatgcc gcagtctgtc       840
     caatatgaat tagcttattc ctatgttaaa ggcgaaaaaa tgagcgataa aaagaaagaa       900
     aacattatga atacaatcag cttaaaatct gacgccaaaa acttacttta ctggatttac       960
     aatggtcgcg gagaatttag taaatcactt gatattgcca aacttttaga cgacccaacg      1020
     cttgcgatgt acagtttaac aaaacaaatt gaacaggtac aaagtgatac aacattaagc      1080
     ggcgatgaaa aagtggaaaa actaaaaact ttggaagaaa gcttgaaaga atacgatgaa      1140
     aaagtaaatg agtcaactac aactgaagat gaaacaacaa atacagaagc aaaataa         1197
//

If you have problems or comments...

PBIL Back to PBIL home page