(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0076

AL591973.LMO0076     Location/Qualifiers
FT   CDS_pept        79817..80869
FT                   /transl_table=11
FT                   /gene="lmo0076"
FT                   /note="similar to E. coli Ada protein (O6-methylguanine-DNA
FT                   methyltransferase)"
FT                   /db_xref="GOA:Q8YAP1"
FT                   /db_xref="InterPro:IPR001497"
FT                   /db_xref="InterPro:IPR004026"
FT                   /db_xref="InterPro:IPR014048"
FT                   /db_xref="InterPro:IPR016221"
FT                   /db_xref="InterPro:IPR018060"
FT                   /db_xref="InterPro:IPR035451"
FT                   /db_xref="InterPro:IPR036217"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036631"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP1"
FT                   /protein_id="CAC98291.1"
FT                   /translation="MITNQRDIDKYYDMLVEKNSNYEGVFFVGVKTTGILCRPTCPAKK
FT                   PLKENCEFFSTAKEALLASYRPCKRCEPLSNPTKLSPAVKLLVDAIEKNPEKKWTDKDF
FT                   DDLSISANTARRQFKKQFGMTFIEYARSRRLGLAFKHIRGGNSIINAQLDSGYESGNGF
FT                   RDAFSKTMGEVPHKSKDITILYSAWLETKLGSMLAISDDDSLLLLEFVDRKGLETEIKK
FT                   LRMRLNAAITPEKTIIIQQIEAELAQYFNGELIDFKTPIRYIGSDFQENVWEELRRIPI
FT                   GETISYKGLAEKLGRSTASRAVARANGANQLSLIVPCHRVINTNGALGGYGGGLARKEW
FT                   LIKHEKMVPK"
     gtgataacga atcagcggga tattgataaa tattacgaca tgttagtgga gaaaaattcg        60
     aattatgaag gcgtattttt tgttggagtg aaaacgacgg gaatactttg tcgcccaacg       120
     tgtccagcga agaaaccctt aaaagaaaat tgtgagtttt tcagtacagc caaggaggcg       180
     ctacttgcat cttaccggcc ttgcaagcgt tgtgaaccgc tctccaatcc gacgaaattg       240
     tcgccagctg tgaagttact tgttgatgca attgagaaaa atccggagaa aaaatggacg       300
     gataaagatt ttgatgattt atccattagc gcaaatacag cgcggcgcca gtttaagaag       360
     caatttggaa tgacttttat tgagtatgca cggtcgcggc gtctcggtct tgcttttaag       420
     catattcggg gtggaaattc aatcattaat gcgcaacttg atagtggtta tgagtctgga       480
     aatgggttcc gagatgcttt ttcaaaaacg atgggggagg ttcctcataa atcaaaagat       540
     atcaccattt tatactccgc ttggcttgaa actaaacttg gatcaatgct cgcaatttct       600
     gatgatgata gtctattgct tctggaattt gttgatcgaa aaggactgga aacagagatt       660
     aaaaaattac gaatgcgctt aaacgcggct attacacctg aaaaaacaat aataattcaa       720
     caaatagaag ccgaattagc gcaatatttt aatggagagt tgattgattt taaaacaccg       780
     attcgctata tcgggtcaga ttttcaggaa aatgtctggg aagagctacg acgaattccg       840
     attggggaaa caatttcgta caaaggtcta gcagaaaaat tagggcgatc aacagcgagt       900
     cgcgccgtgg caagagcaaa tggggccaac caattatccc tcatcgtccc gtgccatcgt       960
     gtaatcaata ctaacggagc attaggaggt tacggcggcg gtcttgctcg aaaagaatgg      1020
     ttaattaaac atgaaaagat ggttccaaag taa                                   1053
//

If you have problems or comments...

PBIL Back to PBIL home page