(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0077

AL591973.LMO0077     Location/Qualifiers
FT   CDS_pept        complement(80892..81530)
FT                   /transl_table=11
FT                   /gene="lmo0077"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001646"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAP0"
FT                   /protein_id="CAC98292.1"
FT                   /translation="MKKITAPRIPDGDLTVYPNDTYFIEDIGEVSEQIFRKTTLTGEIF
FT                   EHFHLETIIFDGCVFDSVSLVSANLTDVVFKNCDLSNLDLMGAIIHRVRFENCKLIGMN
FT                   FSDATLRNCVFVDCYADYVAFRYANLKWVAFEAGAYTNSDFSGAQLVDTYLERLDLNKA
FT                   QFLNCALNGIDLSSCIFESITAMPQDLKGMSIDFSHAPALMPLFGIRVK"
     atgaaaaaaa ttactgcgcc gcggattcct gatggggatt tgacggttta tccgaatgat        60
     acatatttta ttgaagatat tggagaagtt agtgagcaaa tctttagaaa aacgacgcta       120
     accggggaaa ttttcgagca ttttcattta gaaacgatta tttttgatgg gtgtgtgttc       180
     gattctgttt ctcttgtaag cgcgaatttg actgatgttg tatttaaaaa ttgtgatttg       240
     tcgaatttag atttaatggg cgcaattatt caccgagttc gttttgaaaa ttgtaaatta       300
     attggtatga atttcagtga tgctacgctt agaaattgcg tttttgttga ttgttatgcg       360
     gattatgttg cctttcgtta tgctaacttg aaatgggtgg cgtttgaggc gggcgcgtat       420
     acgaacagtg atttcagtgg agctcaactt gtcgatacgt atttggaacg acttgatttg       480
     aataaagcgc agtttttaaa ttgcgcgcta aatgggattg atcttagctc ttgcattttt       540
     gagtctatca ctgcaatgcc gcaagatttg aagggcatga gcattgattt ttctcatgct       600
     cctgccttga tgccgttgtt tgggatacgg gttaaataa                              639
//

If you have problems or comments...

PBIL Back to PBIL home page