(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0107

AL591973.LMO0107     Location/Qualifiers
FT   CDS_pept        complement(113313..115094)
FT                   /transl_table=11
FT                   /gene="lmo0107"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL1"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL1"
FT                   /protein_id="CAC98322.1"
FT                   /translation="MARNKFDIDEELETAFSAAHLKRILVYVKPYQKSIYITLFVILLA
FT                   NVATMIGPYLTKIVIDDTIPNKNMTQLFWIAVIFIVSVIVTGLCMRYRIRSITLIGQDI
FT                   LKDMRTAIFGHLQKLPFSYFDSRPHGKILIRVVNYINMLSDLLSNGLINLISDILSVIV
FT                   TLGFMLMIDPVLTLYSLALIPVLFVIVMVIKTAQRKAYQVLSNKQSNMNAYIHESIAGI
FT                   KVTQSFSREEENFEIFTEVSNEYRRSWMKAVKIQFLLWPGVQNIAVMTTCLIYFVGIKG
FT                   YGVDVSTGTLIAFIGYVGNFWNPVINIGNFYNSLITATTYLERIFETMDVEPDIKDIPN
FT                   AKKMPPIVGNVDFKDVYFRYEEGVDILKGINFHVDAGESIALVGPTGAGKTTIINLLSR
FT                   FYNINSGEILVDGENVEEVTLRSLRSQMGVMLQDTFIFSGTIIENIRYGKLDATEEEII
FT                   AAAKVVRAHDFISGLKDGYYTEVKERGSTLSAGQRQLISFARALLADPKILILDEATSS
FT                   IDTQTEILLQEGLERLLEGRTSFIIAHRLSTIKNSSRIFYIDNGRIQEAGSHEELMAQH
FT                   GYYYNLYQSQFDMLQAL"
     atggctagaa ataaatttga tattgacgaa gaactggaaa cagccttcag cgccgcacat        60
     ttaaaacgta ttctcgttta cgtaaaacca tatcaaaaat ctatttatat cacgctcttt       120
     gtcatcttat tagcaaatgt agcgacaatg attggcccgt atttaaccaa aatagtcatt       180
     gatgatacga ttccaaataa aaacatgaca caactattct ggattgcggt tattttcatt       240
     gtttccgtca ttgtaactgg actttgtatg cgataccgca ttagatcaat tacgttaatt       300
     gggcaagaca ttttaaaaga tatgcggaca gcgattttcg gtcatttgca aaagcttcct       360
     ttctcttatt tcgacagtcg cccgcacggt aaaatcttga ttcgtgtcgt taattacatc       420
     aatatgctca gtgatttgtt gtccaatggg ctcattaatc tgatttccga cattttaagt       480
     gtaattgtta cgcttggctt tatgctgatg attgatccag ttttaacgct gtatagttta       540
     gcgcttatcc cggttctttt cgtgatcgtc atggtcatta aaaccgcgca acgaaaagcc       600
     tatcaagttc taagcaataa acaatccaac atgaacgcct atatccacga gagcatcgct       660
     ggaattaaag tgacacaaag tttttcacgg gaagaagaga attttgagat tttcaccgag       720
     gtaagtaatg agtaccgtcg ctcttggatg aaagcggtga aaattcaatt cttgctttgg       780
     ccaggggttc aaaatatcgc cgtaatgaca acttgtttaa tttacttcgt tggaatcaaa       840
     ggttacggtg tggacgtttc taccgggaca ctgattgctt tcatcggtta tgttgggaat       900
     ttttggaatc ccgttattaa tattggtaac ttctacaatt cgcttattac cgcaacgact       960
     tatttggagc ggattttcga aacgatggat gttgagccag acattaaaga cataccaaac      1020
     gcgaagaaga tgccgccaat cgttggaaat gttgacttta aagatgttta tttccgttac      1080
     gaggaaggcg tggacatttt aaaaggaatt aactttcatg tggatgcggg tgagtcgatt      1140
     gcgctcgttg gtccgactgg tgcaggaaaa acgaccatca tcaacttgct cagccgtttt      1200
     tataatataa attccggaga aattttagtt gatggggaga atgtcgaaga agtcacactt      1260
     agatcactca ggtcccaaat gggcgtcatg ctccaagata cctttatttt ctcaggaacg      1320
     attatcgaaa atattcgcta cgggaagcta gatgccacgg aagaagaaat tattgcagca      1380
     gccaaagtcg ttcgcgctca tgatttcatt tccggattaa aagatggtta ttataccgaa      1440
     gtcaaagagc ggggcagcac cctttcagct ggtcagcgac aactgatttc ctttgcccgt      1500
     gctcttttag ccgacccgaa aatccttatc cttgatgaag caacttcaag tattgataca      1560
     caaacagaaa tcttactcca agaagggctt gagcgactac tggaaggccg aacttccttc      1620
     attatcgcgc acaggctttc gacaatcaaa aacagttcgc gcatcttcta cattgataat      1680
     ggccgcattc aagaagctgg cagtcacgaa gaactgatgg cacagcacgg ctattactat      1740
     aatttatatc aatcacagtt tgatatgttg caagctttat ag                         1782
//

If you have problems or comments...

PBIL Back to PBIL home page