(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0108

AL591973.LMO0108     Location/Qualifiers
FT   CDS_pept        complement(115087..116829)
FT                   /transl_table=11
FT                   /gene="lmo0108"
FT                   /note="similar to ABC transporter, ATP-binding protein"
FT                   /db_xref="GOA:Q8YAL0"
FT                   /db_xref="InterPro:IPR003439"
FT                   /db_xref="InterPro:IPR003593"
FT                   /db_xref="InterPro:IPR011527"
FT                   /db_xref="InterPro:IPR017871"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="InterPro:IPR036640"
FT                   /db_xref="InterPro:IPR039421"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAL0"
FT                   /protein_id="CAC98323.1"
FT                   /translation="MESMKWIWQYVRKYRLLMIGVFILIFIASGISIIYPLLGGKVIDD
FT                   VVYQNKTNLLIPLLLIMIISTIIRTICRYTYQIMCERIGQNSLFRIREDLYKKLQSLDF
FT                   DFFNNTRVGDIMARMTGDTDAIRHFVSWVSYNILENVFLFSFAIIIMATIDWKLTLALV
FT                   IVTPLIAVLTMKMSSKAQPVFYEIRESFSRLNSMVEENISGNRVVKAFAREDFEMKKFH
FT                   EHNEDFKKRNLDSADVSRTYLPVLDSLAGMLVVITLIFGGYLVIKGQMTLGDLVAFNGF
FT                   LWMLNGPMRMSGWLINDVQRFIASSFKIQDMMVTDAKIPIHAEKPAPSLQGHVEFKNVS
FT                   FHFEDDPNTDVLKNISLKASPGQTIAILGETGAGKSTLVNLICRFYDPTSGEILIDGVD
FT                   ARKWHVRELRNHIATVMQDIFLFSDTIEGNIAFGAPDATMEDVRRMARIADADHFIETM
FT                   PESYDTIVGERGVGLSGGQKQRISLARALLKNPSILILDDTTSAVDMETEVKIQGELKK
FT                   ITENTTTFIIAHRISSVKEADEILILNHGEIIERGTHTSLLAEKGYYFDIYNKQLGTEA
FT                   NVNG"
     atggagagta tgaaatggat ttggcaatac gtccgaaaat atcgattgct tatgattggt        60
     gtatttattt taatttttat tgcttctggt attagtatta tttatccgtt acttggcggg       120
     aaagtgattg atgatgttgt ctatcaaaat aaaacgaatt tgcttatccc gttactatta       180
     atcatgatta tctcgacaat tattcgaact atttgccgtt atacctatca gattatgtgc       240
     gagcgaatcg ggcaaaattc cctgttccga attcgggaag acttgtataa aaagttgcaa       300
     tcactcgatt ttgacttttt caataatacg cgcgttgggg atattatggc gcggatgact       360
     ggtgatacgg atgcgattcg tcattttgtt tcgtgggtat cttacaatat tttggaaaat       420
     gtatttttgt ttagttttgc gattattatt atggccacga ttgactggaa attaacgctt       480
     gcacttgtta tcgtaacgcc acttattgcc gttttaacga tgaaaatgtc tagcaaagcc       540
     caaccagttt tttatgaaat tcgggaaagt ttttcgcgac ttaattcgat ggtggaagaa       600
     aatattagcg gaaatcgcgt cgtaaaagct ttcgcacgag aagattttga aatgaagaaa       660
     ttccatgaac ataatgagga tttcaaaaaa cgtaatttag attctgccga tgtttccaga       720
     acctatttgc cagtgctcga ttcgctcgcg ggtatgctcg ttgtcatcac gcttattttc       780
     gggggctatt tagtcattaa aggacaaatg acgcttggag atttagttgc cttcaatgga       840
     ttcctatgga tgctgaacgg cccgatgcgg atgagtggct ggctaattaa cgacgttcaa       900
     cgctttatcg cttcttcgtt taaaattcaa gacatgatgg tgactgacgc taaaatcccc       960
     atccacgctg aaaaacctgc gccatcactt caaggtcacg tcgagttcaa aaatgtcagt      1020
     tttcatttcg aggacgaccc aaacacggac gtactcaaaa atatttcact aaaagcatct      1080
     ccaggacaaa cgattgctat tctgggtgaa actggtgcag gaaaatcaac actcgtcaac      1140
     ttaatttgcc ggttttacga tccgacttct ggtgaaattt taattgatgg tgtcgatgcg      1200
     cgaaaatggc atgtgcggga acttagaaac catattgcca cagtaatgca agatattttc      1260
     ctgttttctg atacgattga aggaaatatt gcatttggcg ctccggatgc aacaatggaa      1320
     gatgtccggc gcatggcacg aattgcggac gcggaccact ttattgaaac aatgcctgaa      1380
     agttatgaca cgattgtcgg cgaacgcggt gttggacttt ctggagggca aaagcagcgc      1440
     atatctttag cgcgtgctct tttaaaaaat ccatccattt tgattttgga tgataccact      1500
     tccgctgtcg atatggaaac cgaagtgaaa atccaaggtg aattaaaaaa aatcacggaa      1560
     aatacgacaa cctttattat cgcgcaccga atttcttctg taaaagaagc cgatgaaatt      1620
     ttaattttaa accatggcga aatcatcgaa cgaggtacac acaccagttt gctagcagaa      1680
     aaaggttatt attttgatat ttacaataaa caacttggaa cggaggcgaa tgtgaatggc      1740
     tag                                                                    1743
//

If you have problems or comments...

PBIL Back to PBIL home page