(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0113

AL591973.LMO0113     Location/Qualifiers
FT   CDS_pept        complement(120654..121106)
FT                   /transl_table=11
FT                   /gene="lmo0113"
FT                   /note="similar to protein gp35 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK5"
FT                   /protein_id="CAC98328.1"
FT                   /translation="MYEKLVNKYQDEVTIREEKMPYKLPGLYLNGMIFISKDQSSIEKG
FT                   CVLVEELMHYKYTVGNITKQETIMDKKQEIFARRKGYEELIPLDDIIACFYLGLREYFE
FT                   VAEFLEVTEEFLRHTVSHYAEKYGPMYDYGGYFINFGNSIDVYKKF"
     ttgtacgaaa aattggtaaa taaataccaa gatgaggtaa caatcagaga agagaaaatg        60
     ccttacaaac ttccgggact ttatttaaat gggatgattt ttattagtaa ggatcaatct       120
     tccattgaaa aaggctgtgt tttagtagaa gaattgatgc attacaaata cactgtaggt       180
     aatatcacca aacaggaaac aatcatggat aaaaaacaag aaattttcgc tcgtcgcaaa       240
     ggttatgagg aactaatacc gcttgatgac atcattgctt gtttttatct aggcttacga       300
     gaatattttg aagtagcgga gtttttagag gtaacagaag aatttttgcg ccatacagtt       360
     tctcattacg cggaaaaata tggtccaatg tatgattatg gtggatattt cattaatttt       420
     ggcaattcca ttgatgttta caagaagttt tga                                    453
//

If you have problems or comments...

PBIL Back to PBIL home page