(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0123

AL591973.LMO0123     Location/Qualifiers
FT   CDS_pept        127188..128324
FT                   /transl_table=11
FT                   /gene="lmo0123"
FT                   /note="similar to protein gp18 from Bacteriophage A118"
FT                   /db_xref="InterPro:IPR010572"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAK1"
FT                   /protein_id="CAC98338.1"
FT                   /translation="MDYVIIQSMDKEVEEILTDIDYGSFSYDYEKNTSRAISFTVNKTK
FT                   QNAAIFDLVGNEAILTYQGQQFVIKKCTPKSIGGTLSKQITAQHICYTVQDHVQYNVKS
FT                   GRKKYSIQTVLEFALQDNVLGFSYEIQGSFPLVELEDLGNKNGLELVNLCLEEFGAILF
FT                   ADNKKLYFYDEKSWYVKTEKQFRYLYNTEEVSVDTNTDNLKTEIKCYGKQKENADKLTG
FT                   DNKYMAVVTYTSPNEAIYGKRMANAKSDDKITNNDDLLIFAKKQILDVPETALTISYKG
FT                   KEPVSERDVWYFIHEPMGFETEVKVTKIKSSHPWSKKFQEIGFSNSRRDMVRIQTQIAN
FT                   QVKKASVDTNKINSFSSIAMNAYDSRILTEVVGVVDGD"
     atggattatg tgattattca aagtatggac aaagaagtgg aagagattct tacagacata        60
     gattacggct ccttttccta cgattatgaa aaaaatacaa gtcgtgctat ttcgtttact       120
     gtgaacaaaa cgaaacagaa tgcagcaatt tttgacttgg taggaaatga agcaatttta       180
     acatatcaag ggcagcaatt tgttattaaa aaatgtacgc caaaatctat tggaggaaca       240
     ctttcaaagc agattacggc ccagcatatt tgttatacag tgcaagatca tgtgcagtat       300
     aacgtgaaat ctggacgaaa aaaatattcg attcaaacgg tattggaatt tgcgttacaa       360
     gataatgtac taggattttc ttatgaaatt caagggagtt ttcctttagt tgaattagag       420
     gacttaggaa ataaaaatgg cttagagcta gtgaatttat gtttggaaga attcggagca       480
     attttatttg cagataataa aaagctttat ttttacgatg aaaaaagctg gtatgtaaag       540
     acagagaagc aatttcgtta tttatataat acagaagaag tttcggtgga tacgaacaca       600
     gacaatttga agacggagat aaaatgttac ggcaagcaaa aagagaatgc cgataagctg       660
     actggagata ataagtacat ggcggttgtc acgtatactt cgccgaatga ggctatttac       720
     gggaaacgaa tggcaaatgc taaaagtgat gataaaatca cgaacaatga tgacttatta       780
     atttttgcaa agaagcaaat tctagatgtt ccagaaacag cgcttactat ttcttacaaa       840
     ggaaaagaac ctgtttcaga gcgggatgtt tggtatttca ttcatgaacc gatggggttt       900
     gaaacagaag taaaagtaac gaaaattaaa tcgagtcatc cttggagtaa gaagtttcaa       960
     gaaattggct tcagtaattc gcgacgggat atggtccgaa ttcaaacaca aattgctaat      1020
     caagtgaaaa aagcgagcgt ggatacaaat aaaatcaatt cgttttcgag catcgcaatg      1080
     aatgcttatg attcacgaat tttaacggaa gtagtaggtg tggtagatgg cgactga         1137
//

If you have problems or comments...

PBIL Back to PBIL home page