(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0127

AL591973.LMO0127     Location/Qualifiers
FT   CDS_pept        129694..130230
FT                   /transl_table=11
FT                   /gene="lmo0127"
FT                   /note="weakly similar to protein gp20 from Bacteriophage
FT                   A118"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ7"
FT                   /protein_id="CAC98342.1"
FT                   /translation="MTKIVKMSEKNEHGTLEQFYPETHAEAVKGLVSVSEEEKTIWDQK
FT                   ESTAGAEQKANTALNSAKDYVDTIGEGTVIFKGANLMGAGQSFKWDASKLKFGMTLLFS
FT                   RYDAANNTPQDYYYHSVFLSKAQLVELAGKGILVQMPSTTYGDRKYLYVSTTGLSGHFD
FT                   NSNYAAWALRQVTIM"
     atgactaaaa ttgtaaaaat gtcagagaag aatgaacatg gaactctaga acaattctat        60
     ccagaaacac atgcagaggc tgttaaagga cttgtgtcgg tttcagagga agagaaaaca       120
     atttgggatc aaaaggaaag tacggcgggt gcagagcaaa aagcaaacac agccttaaat       180
     agtgctaaag attatgtgga tacgataggt gaaggaacgg tgatttttaa aggcgctaac       240
     cttatgggag ctggccaatc atttaaatgg gacgcttcta aactgaaatt tgggatgact       300
     ttgttattta gtcgctatga tgcggcaaat aatacaccgc aagattatta ttatcattct       360
     gtattcttat ctaaggcaca attagttgag cttgcaggaa aaggtatttt agttcaaatg       420
     ccatcaacga cttatggaga tcgaaaatat ctgtatgttt caacaactgg gttatctgga       480
     cattttgata attcgaatta tgcggcttgg gctcttcgcc aagtaacaat tatgtaa          537
//

If you have problems or comments...

PBIL Back to PBIL home page