(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0128

AL591973.LMO0128     Location/Qualifiers
FT   CDS_pept        130249..130671
FT                   /transl_table=11
FT                   /gene="lmo0128"
FT                   /note="similar to a protein from Bacteriophage phi-105 (ORF
FT                   45)"
FT                   /db_xref="GOA:P58702"
FT                   /db_xref="InterPro:IPR006480"
FT                   /db_xref="UniProtKB/Swiss-Prot:P58702"
FT                   /protein_id="CAC98343.1"
FT                   /translation="MEVILKFGILGFGAIFGYLFGEVDLLVKVLVCFIVADYISGLLAS
FT                   GYLGELSSKMGFKGIAKKIAILILVAIAHQIDLILGTHNTTRDAVIFFYLANELISILE
FT                   NFVRMGMKVPEVLKNLILIFDAKSGEDEEKHDKDMD"
     atggaagtca tactaaaatt cgggatttta ggttttggcg cgatatttgg atacttgttt        60
     ggggaagtgg atttattggt aaaagtgctg gtgtgcttta ttgtagctga ctatatttct       120
     gggctactcg cttcagggta tcttggggaa cttagcagca aaatgggttt caaaggaatc       180
     gcgaaaaaaa tcgctatctt aattttagtg gctattgcgc atcaaataga tttgattctg       240
     ggaacgcata atacaacgcg ggatgcggtt atctttttct atttagcgaa tgagctgatt       300
     tctatcttgg aaaatttcgt tcgaatggga atgaaggtcc cggaagtatt gaaaaattta       360
     attttgattt tcgatgcaaa gtcaggagag gatgaggaaa aacatgacaa agatatggat       420
     tga                                                                     423
//

If you have problems or comments...

PBIL Back to PBIL home page