(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0130

AL591973.LMO0130     Location/Qualifiers
FT   CDS_pept        complement(131419..133773)
FT                   /transl_table=11
FT                   /gene="lmo0130"
FT                   /note="similar to 5'-nucleotidase, putative peptidoglycan
FT                   bound protein (LPXTG motif)"
FT                   /db_xref="GOA:Q8YAJ5"
FT                   /db_xref="InterPro:IPR004843"
FT                   /db_xref="InterPro:IPR006146"
FT                   /db_xref="InterPro:IPR006179"
FT                   /db_xref="InterPro:IPR008334"
FT                   /db_xref="InterPro:IPR029052"
FT                   /db_xref="InterPro:IPR036907"
FT                   /db_xref="InterPro:IPR041498"
FT                   /db_xref="UniProtKB/Swiss-Prot:Q8YAJ5"
FT                   /protein_id="CAC98345.1"
FT                   /translation="MKVNKFFKKTTHVLLVAGLTIGLTAPFTGTTAQAAADTVPIQILG
FT                   INDFHGALETASKDASGSPIGGADYLATNLDNATNSFLQANPGATTDNAIRVQAGDMVG
FT                   ASPAVSGLLQDEPTMKVLQKMNFEVGTLGNHEFDEGLPEYKRILDGVSTNKFGPIVEAY
FT                   PRVKSDMKIVAANVVNKGTNTVAEGFLPYYVKEIDGVKVGFIGIVTTEIPNLVLANHIK
FT                   DYDFLDEAETIVKYSAELRGQGVNAIVVLSHVPALSTGNPNTGTKQDVAGEAANMMTKA
FT                   NELDPNNSVDLVLAGHNHQYTNGLVGKTRIVQSYNNGKAFSDVTGELDKTTGDFVSPPD
FT                   AKITYNTRSVTPNADITAVTEDAKSRIEGVINETIGLANKDVISRDTNPDNKAIDDKES
FT                   ELGNMITDAQRYMANKAGADVDFAMTNNGGIRSDLTTRLANGQNEITWGAAQAVQPFGN
FT                   ILQVVEMTGADILEALNQQYLSNQTYFLQISGLKYTFTDTDDLDHAYKVASVTTEDGTP
FT                   LKTDQKYKVVINDFLFGGGDGFSAFKKANLVTAIDPDTETFINYIKDQKAAGKVITAQK
FT                   EGRKVYKSQAEIDKETKDAAIKAIKEATKINKLAEKDKTLTGTTLPGATVSVQKATANA
FT                   RMALAAGPNATADANGKFSVDVTSLNLKKGDQITTTITDPNGYSTTFQATVQAAATTPP
FT                   DNGNGGTDNGNGNGNNGGTDGNGGTNNGNGSGTNGGTTTTEDPTTTTSNTSTTGTSSNT
FT                   SLPTTGDTAGLATVFGVILTTTALYVLRKRS"
     gtgaaagtga acaaattttt caagaaaact acacatgttt tactcgtagc agggctcaca        60
     atcggactta cagcaccatt caccgggaca acagcacaag cagcagcgga taccgttccc       120
     attcagattt tgggaataaa tgatttccac ggagcgcttg aaacagcctc taaagatgca       180
     tcaggctcac caattggcgg agcagattac ttagctacca atttggacaa tgccactaac       240
     tcatttttac aggcaaatcc tggggcgaca actgacaatg ctatccgtgt tcaagcgggc       300
     gacatggtcg gcgcaagtcc agcagtatca ggtttacttc aagacgagcc aacgatgaaa       360
     gttctccaaa aaatgaattt cgaagtcggc acattaggta accatgagtt tgatgaagga       420
     ttaccagaat acaaacgaat tttggacgga gtttctacaa acaaattcgg accaatcgta       480
     gaagcttatc cacgcgttaa aagtgacatg aaaatcgtcg cagctaacgt tgtcaacaaa       540
     ggaacaaaca cagtcgcaga aggcttttta ccatactatg taaaagaaat tgatggcgtc       600
     aaagttggct tcatcggtat cgttacaaca gaaattccta acttagttct tgcgaatcat       660
     attaaagact acgatttcct tgacgaagca gaaacaatcg tcaaatactc tgctgaactt       720
     agaggccaag gcgttaacgc aatcgttgtt ttatctcacg ttcccgcact ttctactgga       780
     aatccaaata ctggaacaaa acaagatgta gctggcgaag ctgccaatat gatgacaaaa       840
     gcaaacgaat tagacccaaa taactcggtc gatttagtcc ttgctggtca caatcaccaa       900
     tacacaaatg gattagttgg aaaaactcgt atcgtccaaa gttacaacaa tggtaaagct       960
     ttttcagatg taactggcga actcgataaa acaactggcg atttcgtttc accacctgac      1020
     gctaaaatta catacaacac gagaagcgtc acaccaaatg ccgatattac agcagtaact      1080
     gaagatgcga aaagccgcat tgaaggggtt atcaacgaaa ctatcggact agcgaataaa      1140
     gacgttattt ctcgtgacac caatccagat aacaaagcaa ttgatgataa agaatcagag      1200
     cttggtaata tgattacgga tgcgcaacgt tacatggcaa ataaagccgg cgccgatgtc      1260
     gactttgcta tgactaacaa cggcggaatt cgttctgacc ttactactcg tcttgcaaat      1320
     ggccaaaacg aaatcacatg gggcgcggct caagctgttc aaccatttgg taacattctt      1380
     caagtagtcg aaatgactgg tgctgatatt ttggaagctc taaaccaaca atatttaagc      1440
     aaccaaactt acttcctaca aatttctgga ctaaaataca ctttcacaga tacagatgac      1500
     ttggatcacg cgtacaaagt tgcgagcgtt acaacagaag acggaactcc tttaaaaact      1560
     gaccaaaaat acaaagtcgt aatcaatgac ttcctatttg gcggcggcga cggattctca      1620
     gccttcaaaa aagcaaatct agtaactgca atcgacccag atactgaaac attcatcaac      1680
     tacatcaaag accaaaaagc tgctggaaaa gtcattacag ctcaaaaaga aggacgtaaa      1740
     gtctacaaat cccaagctga aatcgacaaa gaaaccaaag atgcagctat caaagccatc      1800
     aaagaagcaa caaaaatcaa caaactagcc gaaaaagaca aaactctaac tggaactact      1860
     ttaccaggag ctacagtttc cgttcaaaag gcaactgcta acgcaagaat ggcgcttgct      1920
     gccggaccta acgcaacagc tgacgcaaat ggcaagtttt ccgtagatgt aacatcttta      1980
     aaccttaaaa aaggcgacca aatcacaaca actatcactg acccgaacgg atacagcacc      2040
     actttccaag caacggttca agctgcggca acgactcctc cagataatgg aaacggcggc      2100
     acggacaatg gtaatggaaa cggaaataac ggaggaacgg atggtaatgg tggaacaaac      2160
     aacggtaacg gatccggcac aaacggcgga actactacta ccgaagatcc tacaactacg      2220
     acatcaaaca catcaacaac aggaacttct tccaatactt ccttaccaac aactggtgat      2280
     acagctggat tggcaactgt atttggtgtt attttaacaa ctactgcgct ttatgttttg      2340
     cggaagagaa gttaa                                                       2355
//

If you have problems or comments...

PBIL Back to PBIL home page