(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0131

AL591973.LMO0131     Location/Qualifiers
FT   CDS_pept        133961..134710
FT                   /transl_table=11
FT                   /gene="lmo0131"
FT                   /note="conserved hypothetical protein"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="PDB:4Q6J"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ4"
FT                   /protein_id="CAC98346.1"
FT                   /translation="MDISSTEIWDAIRRNSYLLYYQPKVDAKTNKIIGFEGLVRLKTAT
FT                   TILAPIDFFDDIVLLNATREMQDFVAETAIKQINQLGGRFSISINIPAHYVASSTYMTF
FT                   LHDYVKEHLKYPECLEIEIIERGEITELAIADKNLRKIKDLGVKVSMDDFGKGYSSLAY
FT                   LRSLPIDIVKTDMSFIALLKTDRKQQIIIRAIVNLCHDLGGKVVTEGVEDMEQVEKLRE
FT                   MKVDYFQGYYFSRPLPMEEIKQKYSIV"
     atggatatct cgagcacgga aatatgggat gcgattagga gaaatagtta cttactttat        60
     tatcaaccaa aagtagacgc gaaaacaaat aaaatcatcg gttttgaagg tttagttcga       120
     ctaaaaactg cgacgactat tctagctcca attgatttct ttgatgatat tgtcctttta       180
     aatgcaacga gggaaatgca agattttgtt gctgaaacag cgataaagca aattaaccag       240
     ttaggtggac gtttttctat ttctattaac attccggcgc attatgtagc aagcagcacg       300
     tatatgactt ttttacatga ttatgtgaaa gaacatttaa agtatccaga atgcctagaa       360
     atagagatta tcgaacgggg ggaaataacg gaacttgcta tcgcggataa aaacttacga       420
     aaaataaaag accttggtgt caaagtgagt atggatgatt ttggaaaagg ttatagctcg       480
     cttgcgtatt tgcgtagctt accgattgat attgtgaaaa cagatatgtc atttatcgcg       540
     cttttaaaaa cagatcgaaa acaacaaatt attattcgcg caattgtcaa tttgtgtcat       600
     gatttaggcg ggaaagtagt tacagaaggt gtagaagaca tggagcaagt ggaaaaatta       660
     cgggaaatga aagtggacta tttccaaggt tattatttta gccgtccgct cccaatggaa       720
     gaaattaaac aaaagtattc cattgtatga                                        750
//

If you have problems or comments...

PBIL Back to PBIL home page