(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0133

AL591973.LMO0133     Location/Qualifiers
FT   CDS_pept        136469..136702
FT                   /transl_table=11
FT                   /gene="lmo0133"
FT                   /note="similar to E. coli YjdI protein"
FT                   /db_xref="InterPro:IPR010693"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ2"
FT                   /protein_id="CAC98348.1"
FT                   /translation="MDEETLLERGYRKYRGADVDIYFNTNVCEHSGNCVKGNVELFNLD
FT                   RKPWIMPDNVSKEEAKRVIHTCPSGALQYIEK"
     atggacgagg aaacgctgct tgagcgaggc taccgtaagt atcgcggggc ggatgtagat        60
     atttatttta atacaaatgt ttgcgagcat tcgggtaatt gtgtaaaagg taacgtagaa       120
     ctgtttaatt tggaccgaaa accgtggatt atgccggata atgtatcgaa agaagaggcg       180
     aagcgggtga ttcatacttg cccaagtgga gcacttcaat atatcgagaa atag             234
//

If you have problems or comments...

PBIL Back to PBIL home page