(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0134

AL591973.LMO0134     Location/Qualifiers
FT   CDS_pept        136714..136992
FT                   /transl_table=11
FT                   /gene="lmo0134"
FT                   /note="similar to E. coli YjdJ protein"
FT                   /db_xref="InterPro:IPR016181"
FT                   /db_xref="InterPro:IPR031165"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ1"
FT                   /protein_id="CAC98349.1"
FT                   /translation="MEYKNGENRIYAVNDEGVEVGEVTFVPTGEDMFIIDHTGVDDAAR
FT                   GQGIAQELVKRAVEKAKSEGKKIVPLCPFAKAEFSKKPEYQEVEASK"
     atggaatata aaaatggtga aaatagaatt tatgctgtaa atgatgaagg agtagaggtt        60
     ggcgaagtga cttttgtgcc aactggggaa gatatgttta ttattgacca tactggcgtg       120
     gatgatgcgg ctcgtggtca aggaatagcc caagaactcg tgaaacgtgc ggttgaaaaa       180
     gcaaaatcag aagggaagaa aattgttccg ctttgtccat ttgcaaaagc tgagttttct       240
     aagaagccgg aatatcaaga agtagaagca tctaaataa                              279
//

If you have problems or comments...

PBIL Back to PBIL home page