(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0135

AL591973.LMO0135     Location/Qualifiers
FT   CDS_pept        137323..138897
FT                   /transl_table=11
FT                   /gene="lmo0135"
FT                   /note="similar to oligopeptide ABC transport system
FT                   substrate-binding proteins"
FT                   /db_xref="GOA:Q8YAJ0"
FT                   /db_xref="InterPro:IPR000914"
FT                   /db_xref="InterPro:IPR030678"
FT                   /db_xref="InterPro:IPR039424"
FT                   /db_xref="PDB:5ISU"
FT                   /db_xref="UniProtKB/TrEMBL:Q8YAJ0"
FT                   /protein_id="CAC98350.1"
FT                   /translation="MKKFLLVAVISVFALVLTACGGSGASSDKANGSGKAKDGGSLIIG
FT                   VTGDPEVINPNYASDRVTLTIQQAVYAPLFWEVDGKPALAKSLDISDDNLTYTVKLKDG
FT                   LTWHDGKPLTADDVVFTVNSILDTKQNSPNRGNFVFDDKPVKVEAVDDTTVKFTLPTVA
FT                   PAFENTIKTFFPIPKHIFEGVENIEKSDKNKNPIGSGPYKFVEYKTGEYVSLERFNDYF
FT                   DGKPKLDKVTFRITKDQNAANLALQNGEINLKSIQPSDRNKVEKASAVNIITYPENRLS
FT                   YATFNENQPALKSKELRQALSYALDREEIIDAAYGSDEYAKPASSFLTENTKYFTDKVE
FT                   TYDQDIAKAKKLVKESGFDTSQKLTVYYLNNSKSQESIALYLQQQYKEIGVTLDLKPTD
FT                   PNALSNITLDRKNADYSIALNGYIMGNDPDAYKSLYLSDAPYNYSNYHNKDLDALWEKG
FT                   AVTADDKERQEIYEKIQNTIADDAVIYPISYDNAVLALDSRYGGQKAATPQPVTMFRDL
FT                   SKLYLTE"
     atgaagaaat ttttattagt agcggttatc tcggtttttg ccttggtgtt aacggcttgc        60
     ggaggttctg gcgctagttc agacaaagca aacggttcag gcaaagcgaa agacggcggc       120
     tctcttatta tcggagttac aggagatcca gaagttatca atccgaacta cgcttctgac       180
     cgtgtaacat taacgattca acaagctgta tacgcaccgc tattttggga agttgacggg       240
     aaaccggcac ttgcaaaaag cttagatatt tcagatgaca acttaactta cactgtgaaa       300
     ctaaaagatg gtttaacttg gcacgacggc aaacctttaa ctgcagacga tgtagtattt       360
     actgtaaatt ctattttaga tacaaaacaa aacagtccga accgcggcaa ctttgttttt       420
     gacgataaac ctgtaaaagt agaagcagta gacgacacaa cggtgaaatt cactttacca       480
     actgttgctc cagcctttga aaatacaatt aaaactttct tcccaattcc aaaacacatt       540
     tttgaagggg tagaaaacat cgagaaaagt gataaaaaca aaaatccaat cggctcaggt       600
     ccgtacaaat ttgttgaata caaaacaggc gaatacgttt ccttagaaag attcaacgac       660
     tactttgacg gcaaaccaaa attggataaa gttactttcc gaatcacaaa agaccaaaac       720
     gcagctaatt tagccctgca aaatggtgaa atcaacttaa aatccattca accttctgat       780
     agaaacaaag tagagaaagc gagcgcggta aacattatca cttacccaga aaatcgctta       840
     agctatgcga cattcaacga aaaccaacca gcacttaaat caaaagaact tcgccaagcc       900
     ctttcttatg cgcttgaccg tgaagaaatc attgatgcgg cttacggttc agatgaatac       960
     gcaaaaccag cttcctcgtt cctgacagaa aacacaaaat acttcacgga taaagtagaa      1020
     acatacgatc aagacattgc caaagcgaaa aaattagtaa aagaaagtgg ttttgataca      1080
     agtcaaaaac taactgttta ctatttaaac aacagtaaat cacaagaaag tatcgcgctt      1140
     tacttgcaac aacaatacaa agaaatcggc gtgacacttg acttgaaacc aacagatcca      1200
     aatgcactaa gcaacatcac acttgaccgt aaaaacgcag actactctat cgcactaaat      1260
     ggttatatca tggggaacga tcctgatgcg tataaatccc tatacctaag cgatgcgcca      1320
     tacaactact cgaactacca caacaaagat ctagatgcac tttgggaaaa aggtgctgta      1380
     acagctgacg acaaagaacg tcaagaaatc tatgaaaaaa tccaaaacac aattgctgat      1440
     gacgctgtaa tttatccaat ttcttatgat aatgcagtgc tagctcttga tagccgttac      1500
     ggtggacaaa aagctgcaac accacaacca gtaacaatgt tccgtgatct ttctaaatta      1560
     tatttaacgg aataa                                                       1575
//

If you have problems or comments...

PBIL Back to PBIL home page