(data stored in SCRATCH3701 zone)

EMBL: AL591973.LMO0136

AL591973.LMO0136     Location/Qualifiers
FT   CDS_pept        138999..139949
FT                   /transl_table=11
FT                   /gene="lmo0136"
FT                   /note="similar to oligopeptide ABC transporter, permease
FT                   protein"
FT                   /db_xref="GOA:Q92FC3"
FT                   /db_xref="InterPro:IPR000515"
FT                   /db_xref="InterPro:IPR035906"
FT                   /db_xref="UniProtKB/TrEMBL:Q92FC3"
FT                   /protein_id="CAC98351.1"
FT                   /translation="MLKTIIKRVLQIIPMLFIISIISFALIKLAPGDPVNSFVTPDMNP
FT                   DDVERIRQSLGLDQPIYVQYFIWLGNLLQGNLGYSIVNSQPVLQQILERIPATLGLVGT
FT                   SLVLTLLLSIPLGLVAANYENTWIDKVLNGISYIGISIPIFWFGMILIDVFSIQLGWLP
FT                   SLGMRTIGVDSFWDMAEHAILPVITLTFQGCAAYYRYVRSNTINQLKEEYVLFGYAKGL
FT                   SKVQIMGHHVLKNSLLPVITLLGMSLPQVITGAFITESIFSWPGMGSLGINAIFQLDYP
FT                   VIMAITLFSALLLIIGNLLADLAYMIVDPRIREMG"
     atgctaaaaa caatcataaa acgcgtattg caaattattc cgatgctatt tattatctcg        60
     attatttcgt ttgcccttat caaattagca cccggggatc ccgtgaattc ctttgttacg       120
     cctgatatga atcctgacga tgtagagcgg attagacaaa gcttagggct ggatcaacca       180
     atttatgtac aatattttat ttggcttgga aacttgttgc aagggaatct tggttattcg       240
     attgtgaata gccagccagt tttgcaacaa attttagaga gaattccggc gacacttggt       300
     ttggtgggaa cttcgcttgt tctgacgcta ttattatcga ttccacttgg tttagttgcg       360
     gcgaattatg aaaatacgtg gattgataaa gtgttaaacg ggatttctta tatagggatt       420
     tcgattccga ttttttggtt tgggatgatt ttaatagatg tattttcaat tcagctaggt       480
     tggcttccga gtttaggaat gcgaacgatt ggggtcgact ctttttggga tatggcggag       540
     catgcaattt tgccggttat aactctgact ttccaagggt gcgcggcata ctatcgctac       600
     gtccgctcga ataccatcaa ccaattaaaa gaagaatatg ttttgtttgg ttatgcgaaa       660
     ggtctatcca aagtgcaaat tatggggcat catgtcttga aaaattcctt gctaccagtt       720
     ataacactac ttgggatgtc acttccgcaa gtcattacag gcgcttttat taccgaaagt       780
     attttttcat ggccgggcat gggctcgctt ggaattaatg cgatttttca actagattat       840
     ccggttatta tggcgattac gctattttca gcgctgttat taattatcgg aaacttgctg       900
     gccgatttag cttatatgat tgtcgatccg cggattaggg aaatggggtg a                951
//

If you have problems or comments...

PBIL Back to PBIL home page